KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0537Help
Entry
DAMO_0537         CDS       T02155                                 

Gene name
tufB
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
mox  Candidatus Methylomirabilis oxyfera
Brite
Translation factors [BR:mox03012]
 Eukaryotic Type
  Elongation factors
   DAMO_0537 (tufB)
 Prokaryotic Type
   DAMO_0537 (tufB)
Mitochondrial biogenesis [BR:mox03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DAMO_0537 (tufB)
Exosome [BR:mox04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DAMO_0537 (tufB)
  Exosomal proteins of breast cancer cells
   DAMO_0537 (tufB)
  Exosomal proteins of colorectal cancer cells
   DAMO_0537 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase AAA_29 MobB
Motif
Other DBs
NCBI-ProteinID: CBE67613
UniProt: D5MK17
Position
474826..476028
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKEHMNIGTIGHIDHGKTTLTAAITKVLHAANAKVAFVPFDQIDKAPEEKER
GITINIAHVEYETAKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVAASEGPMPQTREH
ILLARQVNVPNLVVFLNKVDLVDDPELLELVELEVRELLTAYNFPGDDIPFVRGSALKAL
ETGSGDRSNPASTPIFELMDAVDAYFPAPVRVLDKPFLMPIEDVFSISGRGTVVTGRVER
GIIKVSDEVELVGIRDTQRTVVTGVEMFRKLLDQGQAGDNVGLLLRGTKREEVERGQVVA
KPGSIPPHTRFKAEAYILTKEEGGRHTPFFNGYRPQFYFRTTDVTGVCTLPAGTEMVMPG
DNVSLAVELIQPIAMEKELRFAIREGGRTVGAGVVSEVLE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgaagttcgagcggacgaaagaacatatgaacatcgggaccatcgggcac
atcgaccacggcaagaccaccctgaccgcggcgatcacgaaggtcctccatgcggcgaat
gcgaaggtcgccttcgttcccttcgaccagatcgacaaggcgccggaggagaaggagcgg
gggatcactatcaacatcgcccacgtcgagtatgagacggccaagcggcactacgcccat
gtcgactgccccggccacgccgactacatcaagaacatgatcaccggcgcggctcagatg
gacggggcgatcctggtcgtcgccgcctctgagggcccaatgccccagacccgcgagcac
atcctcctggcccgacaggtcaacgtccccaacctggtcgtctttctgaacaaggtcgac
ctggtggacgatcccgaactgctcgagctggtcgaactggaggtccgcgagctgctcacc
gcctacaacttcccgggcgacgacatcccctttgtccgcggcagcgcgctcaaagcgctg
gagaccggcagcggtgaccgcagcaacccggcgtccacaccgatctttgagctcatggac
gctgtcgacgcctacttccccgcccccgtccgcgtgctggataagccgttcctcatgccg
atcgaggacgtcttctcgatctccggacgcgggaccgtcgtcaccggccgcgtcgagcgc
ggcatcatcaaggtcagcgacgaggtggagctcgtcggcatccgagatacccagcggacc
gtcgtcaccggggtcgagatgttccggaagctcctcgatcagggccaggccggcgacaac
gtcgggctgctcctgcgagggaccaagcgcgaggaagtagagcgcggccaggtggtggcc
aagcccggctccatccccccccatacgcgctttaaggccgaagcctacatcctcaccaag
gaagagggcggtcgccatacccccttcttcaacggctatcggccccagttctacttccgg
acgactgatgtgacgggggtctgcacgctccccgccgggaccgagatggtcatgccgggc
gacaacgtgagcctcgcggtcgaactgattcagccgatcgccatggagaaggagttgcgc
ttcgcgatccgcgagggcggccgcactgtgggggccggcgtggtgagcgaggtgttggag
tag

DBGET integrated database retrieval system