KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1443Help
Entry
DAMO_1443         CDS       T02155                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00020  Citrate cycle (TCA cycle)
mox00640  Propanoate metabolism
mox00660  C5-Branched dibasic acid metabolism
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
mox01120  Microbial metabolism in diverse environments
mox01130  Biosynthesis of antibiotics
mox01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DAMO_1443 (sucC)
   00640 Propanoate metabolism
    DAMO_1443 (sucC)
   00660 C5-Branched dibasic acid metabolism
    DAMO_1443 (sucC)
Enzymes [BR:mox01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DAMO_1443 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 DUF3509 ATP-grasp Tsp45I
Motif
Other DBs
NCBI-ProteinID: CBE68503
UniProt: D5MFH2
Position
complement(1230850..1232028)
Genome map
AA seq 392 aa AA seqDB search
MKIHEFQAKAILGAYEVPVPKGEAVTTPVDAARVAEQLGGAVVLKAQIHAGGRGKGGGIL
SASSPQEAEELAERLIGSRLVTHQTGPEGRVVKRILVEEQVAVSRELYAGIVLDRRAARP
VMMAGAIGGMEIEEVAAKDPESITRVVVDPAVQLQSFHIRRLVLRLALPQQVQRTATGLF
SALYRVFQEKDCSLVEINPLVITTDGRLLALDAKLNVDDNALFRHADLKALRDPDEELPL
EIEASKFGLNYIKLDGTVGCMVNGAGLAMATMDLVKFVGGEPANFLDVGGGASAEQIEQA
FRILISDRSVRVVLINIFGGILRCERLAEGVIRAVRSLGVTMPIVVRMEGTNVDHGTRML
TESGLNFITAEGMQDAAEKAVKASGQGIGFRV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccatgagtttcaggcaaaggcgatccttggcgcgtacgaggtacccgttcca
aaaggggaggcggtcacgacgcccgttgacgcggcgcgtgttgccgagcagcttggcggc
gctgtggtgctgaaggcccagattcatgcgggcggccgaggcaagggtggcgggatcctg
tcggcatcgtcgccgcaggaggcggaagagttggcggagcggctcatcggttcccgcctg
gtcacccatcagaccggccctgaaggcagggtggtcaaaagaatccttgtcgaggaacaa
gtcgccgtcagccgggagctgtacgccgggatcgtcctggatcgcagggcggcacggccc
gtgatgatggccggcgcgatcggcgggatggagatcgaagaagtggccgcgaaggatccg
gagagtatcacgagagtcgtcgtcgatccggccgttcaacttcagtccttccatattcgc
cgccttgtgttgaggctcgcgctgccgcagcaggttcaacgtaccgctaccggtctattt
tcggccttgtatcgagtgtttcaggagaaagattgttctttggtcgagatcaatcctctg
gtgatcacgaccgatggtcgcttgttggccctggatgccaagctcaatgtcgatgataac
gccctttttcgccacgccgatctgaaggcgctccgtgatccagacgaggagctgccgctg
gagatagaggcgtccaagttcggactaaactatatcaagctcgacggtactgtaggatgt
atggtcaacggagccggcttggcgatggcgaccatggatctcgtcaaatttgtcggcggt
gaaccggccaactttctggatgtcggcggcggcgccagtgctgaacagatcgaacaggcg
tttcgcattctgatctcagaccgatccgtacgtgtggtccttatcaacatcttcggggga
atcctgaggtgtgagcggctggcagagggcgtgattcgtgcggttcgctccctcggggtg
acaatgccgattgtagttcggatggaggggaccaatgtggaccatggtacgcgtatgctt
actgagtccggtctgaatttcatcaccgcagaagggatgcaggatgcggccgagaaggcc
gtgaaggcctccggacagggtatagggttcagggtatag

DBGET integrated database retrieval system