KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1564Help
Entry
DAMO_1564         CDS       T02155                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase (DHPS) (Dihydropteroate pyrophosphorylase)
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00790  Folate biosynthesis
mox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DAMO_1564 (folP)
Enzymes [BR:mox01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DAMO_1564 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CBE68624
UniProt: D5MFU3
Position
complement(1324462..1325313)
Genome map
AA seq 283 aa AA seqDB search
MTQQTQLRFRCRDHLLDIRQKTWIVGVLNITPDSFSDGGRFLDPRAATDQAMRMVEEGAD
IVELGGESTRPGADVVPVDEELRRILPVLRELRPRLAIPVAVDTYKPEVARVALEEGADI
INDVYGVRGEGRLASVVAEKRAGLVIMHMKGIPQDMQIEPRYNDVVGEVSAFLTDRVAFA
EQRGVDPQSIIVDPGLGFGKRSQDNLALLRHLAALHCLGKPIMVGPSRKSLVGEVLKLPV
EQRQHGTAACIAAAVLHGAAFVRVHEVRPCAQLVRMLDAIRGA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacagacgcaattacgcttccgctgcagggaccatctgctggatatccggcaa
aagacctggatcgtcggggtgttgaacatcaccccggattctttttccgatggcggtcgc
ttcctggatcctagggcagccaccgatcaggccatgcggatggtggaggagggagctgat
atcgtggaactgggtggtgagtcaacccgtccaggcgccgacgtcgtccctgtagacgag
gagctgcgtcggatccttccggtgctgcgcgagctgcgacccaggcttgcgattccggtg
gcagtggatacctacaaaccggaggtggcgagggtagcgctggaggaaggggcggatatc
attaacgacgtctatggcgttcgaggtgagggacgcttagcgtcggtggtcgccgagaag
cgcgccggtctcgtcatcatgcatatgaaagggatccctcaagatatgcaaattgagccg
cgctacaacgacgttgtaggcgaggtgtcagccttcctgacagatcgcgtcgcgtttgcc
gaacagaggggtgtggatccgcagtccatcattgtcgatccggggctgggcttcgggaag
cggtcgcaggacaatcttgcgctgcttcggcatctggcggcgttgcattgtctcggtaag
ccgattatggtcggtccatcgcgcaagtcgctggttggggaggtgctgaaactgccggtt
gagcaacgtcaacatggcacggcggcctgtattgcggcagcggtgctgcacggcgcagcc
tttgtccgggtccacgaggttcggccctgcgcgcagctcgttcgaatgctggacgccatc
aggggggcctga

DBGET integrated database retrieval system