KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2165Help
Entry
DAMO_2165         CDS       T02155                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit)
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00630  Glyoxylate and dicarboxylate metabolism
mox00710  Carbon fixation in photosynthetic organisms
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
mox01120  Microbial metabolism in diverse environments
mox01130  Biosynthesis of antibiotics
mox01200  Carbon metabolism
Module
mox_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DAMO_2165 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DAMO_2165 (cbbL)
Enzymes [BR:mox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DAMO_2165 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CBE69215
UniProt: D5MHI3
Position
1870669..1872132
Genome map
AA seq 487 aa AA seqDB search
MAGAAGTSKDPKDRYKAGGVVPYKQMGYWRPEYEPKDTDVIAVFRITPQEGVDPDEAAAA
VAGESSTATWTVVWTDRLTDHDAYRGKAYRVDPVPGSPGQYFAYIAYDLDLFEDGSIVNV
SASIIGNVFGFKPLKALRLEDMRFPVAYLKTFQGPPTGIVVERERLDKFGRPLLGATIKP
KLGLSGKNYGRVVYEALKGGLDFTKDDENINSQAFMHWRDRFLFAMEGVNRASAATGEVK
GHYLNISAGTMEDMYERAEFAKELGSVIIMIDLVIGYTAIQSISKWARKNDMMLHLHRAG
HSTYTRQKTHGVNFRVICKWMRMAGVDHIHAGTVIGKLEGDPYMVKGFYDTLRETHTPMN
LQNGLFFDQDWASLRKVMPVASGGIHAGQMHQLLHYFGEDVVMQFGGGTIGHPTGIAAGA
TANRVALEAMVQARNEGRDYFNEGPEILANAARWCQPLRTALEVWKDITFNYASTDTADF
VPTTTAV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagcagcgggaaccagcaaggatccaaaagaccggtataaggccggcggggta
gtcccctacaagcagatggggtattggcggccggaatatgagccgaaggacaccgacgtg
attgcggtgttccgcatcacccctcaggagggtgtggatccggatgaggcggccgcagcc
gtggctggcgaatcgtccactgccacctggactgttgtgtggaccgaccgtctcaccgat
cacgatgcctatcgcggcaaggcgtacagggtggatcctgtcccgggcagcccgggacag
tatttcgcctacatcgcctacgacctggacctatttgaagacggctcgatcgtcaacgtg
agcgcctccattatcggcaacgtcttcggcttcaagccgctcaaggcgctgcgcctggaa
gacatgcggttccctgtggcctacctcaagacctttcaggggccgcctaccgggatcgtc
gtggagcgcgagcgtctggataagttcggccgcccgctgctgggcgccaccatcaagccg
aagctggggctctccggaaaaaattacggccgcgtcgtgtacgaggcgctcaagggcggc
ctcgacttcaccaaggacgacgaaaatatcaactcgcaggcgtttatgcactggcgcgat
cgtttccttttcgctatggaaggggtcaaccgcgcctcggccgctaccggcgaggtgaag
ggacattacctcaatatcagcgccggcaccatggaagatatgtatgagcgcgccgaattc
gccaaggagttgggcagcgtcatcattatgatcgatctggtcatcggctacaccgcgatc
cagtcgatctcgaagtgggcgcggaaaaacgatatgatgctgcacctgcaccgggcaggc
cattcgacctatacccgtcagaagactcatggcgtcaacttccgcgtcatctgcaaatgg
atgcgcatggccggggtggaccatatccacgccggaaccgtcatcggcaagctcgaaggc
gacccgtatatggtcaaggggttctacgataccctgcgggaaacccataccccgatgaat
ttgcaaaatggcctgttctttgatcaggactgggcgtcgctccgcaaggtcatgccggtc
gcctcaggcggcatccacgccggacagatgcaccagttgctccactactttggagaagac
gtagtcatgcagttcggcggcgggaccatcggccatccgaccggcatcgcggcgggcgcg
acggccaaccgggtcgccctggaagcgatggtccaggcgcgcaacgaagggcgcgattac
ttcaacgaaggcccggagatcctggcgaatgccgcacggtggtgccagccattgcggacg
gcactggaagtctggaaggatattaccttcaactatgcctcgaccgataccgcggacttt
gttccgacgacaacggccgtgtag

DBGET integrated database retrieval system