KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2884Help
Entry
DAMO_2884         CDS       T02155                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00500  Starch and sucrose metabolism
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DAMO_2884 (glgB)
Enzymes [BR:mox01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DAMO_2884 (glgB)
Exosome [BR:mox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DAMO_2884 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CBE69957
UniProt: D5MLQ0
Position
complement(2488076..2490295)
Genome map
AA seq 739 aa AA seqDB search
MLSSLAAEVIEAIVRGEHGDPFAVLGPHEVPIAAEPCVVVRAFLPDVREAMVVHADGEIK
DRPMELVHPDGLFEVVVPTRNGLFPYRLRVVDRQGQGYEIEDPYRFPPTLSDYDLYLLGE
GSHLRNYEKLGAHLMTLGGVPGVRFAVWAPNARRVSVVGDFNRWDGRCHPMRNHPGNGIW
DLFIPSLTENALYKFEIKSQSGEPLALKADPFAFAFEPSPRTASRVFSIDAYRWGDASWM
DARAHQNWLERPVAIYEVHLGSWMRSPEEGHSCLTYRELAHRLADYATEMGYTHVELLPI
TEHPFYGSWGYQTIGYFSPTCRYGTPTDFMYFVDHLHQRGIGVILDWVPSHFPRDPHGLV
YFDGTCLYEHEDPRKGEHREWGTLIFNYGRKEVDNFLLGNALFWLERYHLDGLRVDAVAS
MLYLDYSRQPGEWVPNIYGGHENLEAVAFLKRFNELVYERHPGVITIAEESTAWPQVSRP
TYVGGLGFGLKWNMGWMHDMLGYMTLDPVHRGYHHNNLTFGLLYAFTENFVLPLSHDEVV
HEKGSLLGKMSGDTWQKFANLRSFYVFMYGHPGKKLLFMGGEFGQWREWDHDQSLDWHLL
AEGPHHQGLQRLVRDLNQLYRCQSALHEVDFDPHGFEWIDCHDWQGSIVSFLRRARNPDD
FMIVVCNFTPVPRHDYRIGVPTGGYYVEILNSDAAIYGGSNLGNGGGVEAEPIPGHGRPF
SLLLTIPPLGGLILKPAST
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgctttccagtcttgctgctgaggtgatcgaggcgattgtccggggtgagcacggcgat
ccgttcgccgtactgggcccgcatgaggtacccatcgccgcagagccatgcgtcgtcgtg
cgcgccttcctcccggatgtccgggaggcaatggtcgtccatgccgatggcgagatcaag
gaccggcccatggagttggtacacccggacggtctcttcgaggtcgtcgttccgacgcgg
aacggcctctttccctatcgactgcgtgtcgtagatcggcagggacagggatacgagatt
gaagacccgtaccgttttcctccgaccttgagtgactatgacctgtacctgttgggcgag
ggcagtcacctcagaaactatgaaaagttgggggctcatctgatgaccctcggcggcgta
ccaggggtccgctttgcggtctgggcccccaacgccagaagagtcagcgtcgtcggagac
ttcaatcgctgggatggccggtgccatccgatgcgaaaccatcccggcaacggcatatgg
gatctctttatcccttctctcacggagaacgccctgtacaaattcgagatcaagtcgcaa
tccggcgagccgctcgccctcaaagccgatccgttcgccttcgccttcgagccgtcaccc
cgaaccgcttcgcgcgtgttcagcatcgatgcctaccggtggggggatgcgtcgtggatg
gacgcgcgagcgcatcagaattggcttgagcgaccggtcgcgatctacgaggtgcatctg
ggctcctggatgcggtcgcctgaggaagggcatagctgtctgacgtaccgggagctggct
caccggcttgccgattacgcgacggagatggggtacacgcacgtcgaactacttccgatt
acggagcacccgttttacggctcgtgggggtaccaaaccatcggctacttctcgccaacc
tgccggtatggaacgccgaccgacttcatgtacttcgtagatcacctgcaccagcgcggg
atcggcgtaatccttgactgggtcccctcccatttccctcgtgacccgcacgggctggtc
tacttcgacgggacctgcctctatgagcatgaagatcctcgtaagggcgaacatcgcgag
tggggtacgctcatcttcaattacggccgaaaggaagtggacaacttcctgctgggcaat
gcgctcttctggcttgaacgctatcacctggacggtctgcgggtagacgcggtggcctcg
atgctctacctggactactcgcgtcagcccggcgagtgggttcctaacatctacgggggg
catgagaatctggaggcggtcgccttcctgaagcgcttcaacgaactggtctacgagcgc
catcctggcgtgataaccattgctgaggaatcgaccgcgtggccccaggtctcgcgccca
acctacgtgggcggactcggctttgggttgaagtggaacatgggatggatgcatgacatg
ctgggctacatgacgctcgacccggtccatcgaggctaccaccacaacaacctgaccttt
ggtctgctctatgctttcactgagaacttcgtcctgcccctttcccacgacgaggtggta
cacgagaaaggctcactcctcggcaagatgtcgggtgatacctggcagaagttcgccaac
ctgcgatctttctatgtctttatgtatggacatcccggcaagaagcttctgtttatggga
ggagagttcggtcaatggcgcgagtgggatcacgaccagagcctggattggcaccttctg
gcagaaggtcctcaccatcaagggttgcagaggctcgtgcgggacctgaaccagctctac
cgatgccagtcggctctacacgaggtcgattttgatccgcacggattcgagtggatcgac
tgccatgactggcaggggagcatcgtctcgttcttgcggcgcgccaggaatccggatgac
ttcatgatcgtggtctgtaacttcacccccgtcccgcgacacgactatcgcatcggcgta
ccgaccgggggctactatgtggagatcctgaactcagatgctgcgatctatggtggcagc
aatctcgggaatggcggcggcgtcgaagcagagccgatcccgggtcacggacgaccgttc
tcattgcttctcaccatccctccgctaggcggcttgattctcaagcccgcatccacgtag

DBGET integrated database retrieval system