KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2943Help
Entry
DAMO_2943         CDS       T02155                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00540  Lipopolysaccharide biosynthesis
mox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mox00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DAMO_2943
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:mox01005]
    DAMO_2943
Enzymes [BR:mox01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     DAMO_2943
Lipopolysaccharide biosynthesis proteins [BR:mox01005]
 Unusual sugar
  DAMO_2943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: CBE70016
UniProt: D5MLV9
Position
complement(2536105..2537055)
Genome map
AA seq 316 aa AA seqDB search
MESALITGGAGFIGSNLVLELERRYPDIRITIIDDFRSGEYSNLIGFRGDLVAQDLAGLD
LLGRFQPGEFQVVFHLASITDTTVTDAQQMIWNNVEGFRRVAEFARASGTPLIYASSAAV
YGVCRSGRMQEDQPIRPANVYAFSKTLLENLAKRLDDVSGGFRIVGLRYFNVYGPGETHK
GAAASMIYQLAKQIQSGKRPRIFKRGEQARDFVYVKDVVEATLLAAEANHSGVYNVGSGR
PTSFNEVIALLNKALGTDYEPDYFDNPYPFYQPHTEADVSLARAELDYVPKYPIDRGIAE
YSKQLIETGMGPDALS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgcgctgattacgggtggagccggttttattgggtcgaatctggtcctggag
ctggagaggcgatacccggacattcggatcaccatcatcgatgactttcgttctggtgag
tacagcaatctcattggatttcgaggcgatctggtggcccaggatcttgcagggctagat
cttctcggccggtttcagccgggtgaatttcaggtggtatttcatctggcttcaatcacc
gatacaaccgtcaccgatgcgcagcagatgatttggaataatgtggaaggctttcggcgg
gtggcggagttcgcccgcgcctccgggacgcccctaatctatgcctcttctgccgccgtc
tacggtgtctgccgctcgggccggatgcaggaggatcagcctatccgccctgccaacgtg
tatgccttttcgaagacgctcctggaaaatctggccaagcgtcttgatgatgtttcggga
ggcttcagaattgtcgggctccggtactttaatgtatatggacccggcgaaactcacaaa
ggagctgcagccagcatgatctaccagttggcgaagcagattcaatcgggcaagcggccg
cggatctttaagcggggggagcaggcacgcgactttgtgtacgtgaaagacgttgtggag
gcgacgctgctggccgcagaggccaatcacagcggcgtctacaatgtcggttccgggcgc
cccacctcgttcaatgaggtcattgcgttgttgaataaggccctcgggaccgactatgag
cccgactactttgataacccgtacccattctatcagccgcacaccgaggccgacgtgagc
ctcgcgcgtgcggaattggactatgttccgaagtatccgatcgatcgagggattgcagaa
tacagtaagcagttgatagaaaccggcatggggccggatgcgttgtcgtga

DBGET integrated database retrieval system