KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_0501Help
Entry
MAP_0501          CDS       T00156                                 

Gene name
nhoA
Definition
(GenBank) NhoA
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00983  Drug metabolism - other enzymes
mpa01100  Metabolic pathways
mpa01110  Biosynthesis of secondary metabolites
mpa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MAP_0501 (nhoA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MAP_0501 (nhoA)
   00983 Drug metabolism - other enzymes
    MAP_0501 (nhoA)
Enzymes [BR:mpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     MAP_0501 (nhoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AAS02818
UniProt: Q743U0
Position
528543..529373
Genome map
AA seq 276 aa AA seqDB search
MTLDLGAYFDRIGYGGKAAPNLEVLRALMAAHTGSIPFENLDPLMGVPVDDLSPAALTDK
LVHRRRGGYCYEQNGLLGYALAEIGFRVRRLAGRVVWMQPPDTPPRAQTHTVLAVTFPGS
QGAYLVDVGFGGQTLPSPIRFETGNAQQTTHEPYRLDDRGEGLVLQALVRDEWPPLYVFG
TRTVPQIDLLVGSWYVSTHPSSMFVTGLMVARTTADARWNLAGRELTVHRAQSSEKIRLD
DADAVLDVLGERFGIDVAGIGQRGALLARIEQVLDA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggatctgggcgcgtatttcgaccgcatcggttacggcggcaaggccgcgccc
aacctcgaggtgctgcgggccctgatggccgcgcacaccggctcgatcccgttcgagaac
ctcgacccgctgatgggggtgccggtcgacgacctgagcccggcggcgctgaccgacaag
ctggtccaccggcgccgcggcggctactgctacgagcagaacggcctgctgggctacgcg
ctggccgaaatcggtttccgggtgcgccgattggccggccgggtggtgtggatgcagccg
cccgacacgccgccgcgcgcccagacgcacacggtcttggcggtgacgttcccgggctcg
cagggcgcctacctggtcgacgtcggcttcggtggccagacgttgccctcgcccatccgt
ttcgagaccggcaacgcccagcagaccacccacgagccgtaccggctcgatgaccgcggc
gagggcctggtgctgcaggccctggtgcgcgatgaatggccgccgctgtacgtgttcggc
acccgcaccgtgccgcagatcgacctgctggtgggcagctggtacgtctccacccacccg
tcgtcgatgttcgtcaccgggctgatggtcgcgcggaccaccgccgacgcccggtggaac
ctggccgggcgcgagctgaccgtgcaccgcgcgcagagcagcgagaagatccgcctcgac
gacgcggacgcggtgctcgacgtgctcggggagcggttcggcatcgacgtggccgggatc
ggccagcgcggcgcgctgctggcgcgcatcgagcaggtgctggacgcctga

DBGET integrated database retrieval system