KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_0711c
Entry
MAP_0711c         CDS       T00156                                 

Definition
(GenBank) hypothetical protein
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00903  Limonene and pinene degradation
mpa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP_0711c
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MAP_0711c
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: AAS03028
UniProt: Q742X4
Structure
PDB: 
3UVE

Position
complement(735853..736701)
AA seq 282 aa
MTGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICKPIRAGVVDTAIPASTPEDL
AETADLVKGHNRRIVTAEVDVRDYDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKT
SEEDWTEMIDINLAGVWKTVKAGVPHMIAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHG
VVGLMRAFGVDLGQHMIRVNSVHPTHVKTPMLHNEGTFKMFRPDLENPGPDDMAPICQMF
HTLPIPWVEPIDISNAVLFFASDEARYITGVTLPIDAGSCLK
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaccggacgtgttgagggcaaagtcgctttcgtcaccggggcggcacgcggtcagggc
cgcagccacgcggtgcggttggcccaggagggcgccgacatcatcgccgtcgacatctgc
aagcccatccgggcgggcgtggtggacaccgccatcccggcctccacgcccgaggacctg
gccgagaccgccgatctggtcaaggggcacaaccgcagaatcgtcaccgccgaggtcgac
gtgcgcgactacgacgcgctcaaagccgcggtcgacagcggcgtcgagcagctgggccgg
ctggacatcatcgtggccaacgccggaatcggcaacggcggcgacactttggacaagacc
agcgaagaagactggaccgagatgatcgacatcaacctggccggggtgtggaaaaccgtg
aaagccggtgtgccgcatatgatcgccggcggccgcggcggatccatcatcctgaccagc
tcggtcggcgggctcaaggcctacccgcacaccggccactacgtcgcggccaagcacggc
gtggtcgggctgatgcgcgccttcggagtcgatttgggacagcacatgattcgcgtcaat
tcggtacacccgacgcacgtcaagaccccgatgctgcacaacgagggcaccttcaagatg
ttccgtccggatctggagaacccgggtcccgacgacatggcgccgatctgccagatgttc
cacacgctgcccatcccgtgggtcgagccgatcgacatcagcaacgcggtgctgttcttc
gcctcggacgaagcccgctacatcaccggtgtgaccctgcccatcgatgcgggtagctgc
ctgaaatag

DBGET integrated database retrieval system