KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_1577Help
Entry
MAP_1577          CDS       T00156                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00071  Fatty acid degradation
mpa00072  Synthesis and degradation of ketone bodies
mpa00280  Valine, leucine and isoleucine degradation
mpa00310  Lysine degradation
mpa00362  Benzoate degradation
mpa00380  Tryptophan metabolism
mpa00620  Pyruvate metabolism
mpa00630  Glyoxylate and dicarboxylate metabolism
mpa00640  Propanoate metabolism
mpa00650  Butanoate metabolism
mpa00900  Terpenoid backbone biosynthesis
mpa01100  Metabolic pathways
mpa01110  Biosynthesis of secondary metabolites
mpa01120  Microbial metabolism in diverse environments
mpa01130  Biosynthesis of antibiotics
mpa01200  Carbon metabolism
mpa01212  Fatty acid metabolism
mpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP_1577
   00630 Glyoxylate and dicarboxylate metabolism
    MAP_1577
   00640 Propanoate metabolism
    MAP_1577
   00650 Butanoate metabolism
    MAP_1577
  Lipid metabolism
   00071 Fatty acid degradation
    MAP_1577
   00072 Synthesis and degradation of ketone bodies
    MAP_1577
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP_1577
   00310 Lysine degradation
    MAP_1577
   00380 Tryptophan metabolism
    MAP_1577
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAP_1577
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP_1577
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAP_1577
Enzymes [BR:mpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAP_1577
Exosome [BR:mpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAP_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OB_aCoA_assoc
Motif
Other DBs
NCBI-ProteinID: AAS03894
UniProt: Q73ZM5
Position
1733691..1735175
Genome map
AA seq 494 aa AA seqDB search
MTVDPRTPALIGYGQVNHRDDIDPAVRSVEPVDLMAAAVERAADAAVIEAVDSIRVVNIL
SAQYRDPGLLLGQRIGARDFGTLYTPVGGNVPQSLVNQACLDIQRGRANVVLLAGAETWR
TRRGLRAKGGKLVWTEQDRSVPMAEVSGEDVAMAGEAEIRISLDRPAYVYPLFEQALRVA
TGESVEDHLTRIGRLWARFNAVAVDNPHAWIRTPHSADDICRAGPHNRMISWPYTKLMNS
NNMVDQGAALVLTSVEQARRLKVPPERWVYPLAGTDAHDTASIAERHELHRSAAIRIAGA
RALQLAGLGIDDVDHVDLYSCFPSAVQVAAAELGLGLDDPARPLTVTGGLTFAGGPWSNY
VMHSIATMAELLVANPGRRGLITANGGYLTKHSFGVYGTEPPAEFRWEDTQSAVDREPTT
DAAVEWEGVGTVEAWTTPHDREGEPEKAFLAVRTPDGSRALAVVTDRAAAQATVREDIGG
AKVAVAADGSATLQ
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgacccccgcaccccggcgctgatcggctacggccaggtcaaccatcgcgac
gacatcgacccggcggtgcgctccgtcgagcccgtcgacctgatggccgccgccgtcgag
cgggccgccgacgccgcggtgatcgaggcggtggattccatccgggtggtcaacatcctc
tcggcgcagtatcgcgatcccgggctgctgctcggccagcgcatcggcgcccgcgacttc
ggcacgctgtacaccccggtcggcggcaacgtgccgcaatcgctggtcaaccaggcatgc
ctggatatccagcggggccgcgccaacgtggtgctgctggccggcgccgaaacctggcgc
acccgacggggattgcgggccaagggcggcaaactggtctggaccgagcaggaccgctcg
gtgccgatggccgaggtcagcggcgaagacgtggcgatggccggcgaggccgagatcagg
atctccctggaccggccggcctacgtctaccccctgttcgagcaggcgctgcgggtggcc
accggcgagtcggtcgaggaccacctcacccgcatcgggcggctgtgggcgcggttcaac
gcggtggcggtggacaacccgcacgcctggatccgcaccccgcacagcgccgacgacatc
tgccgggcggggccgcacaaccggatgatcagctggccgtacaccaagttgatgaactcc
aacaacatggtcgaccagggtgcggcgctcgtactgacctcggtggagcaggcgcgacgg
ctgaaggtcccgcccgagcggtgggtctacccgctggcgggcacggatgcgcatgacacc
gcgtccatcgccgaacgccacgagctgcaccgctcggcggccatccggatcgccggcgcc
cgggcgctgcaactggccgggctgggcatcgacgacgtcgaccacgtggacctgtactcg
tgctttccctccgcggtgcaggtggcggcggccgaactcgggctgggcctcgacgacccc
gcccgaccgctcacggtgaccggcgggctgacgtttgcgggcgggccgtggagcaactac
gtcatgcactccatcgccaccatggccgagttgctggtggccaatcccgggcggcgcggt
ttgatcaccgccaacggcggctacctgaccaagcacagcttcggcgtctacggcaccgaa
ccgccggccgaattccgttgggaggacacccaatcggccgtcgaccgggagccgacgacc
gatgcggcggtcgagtgggagggcgtcggcaccgttgaggcctggacgacgccccacgac
cgcgagggtgagccggagaaggcgttcctggcggtgcgcaccccggacgggtcgcgcgcc
ctggccgtcgtcaccgatcgcgccgccgcgcaggcaaccgtgcgcgaggacatcggtggc
gccaaggtcgccgtcgccgccgacggcagcgcgacgctgcagtag

DBGET integrated database retrieval system