KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_1714Help
Entry
MAP_1714          CDS       T00156                                 

Gene name
fadA
Definition
(GenBank) FadA_2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00071  Fatty acid degradation
mpa00072  Synthesis and degradation of ketone bodies
mpa00280  Valine, leucine and isoleucine degradation
mpa00310  Lysine degradation
mpa00362  Benzoate degradation
mpa00380  Tryptophan metabolism
mpa00620  Pyruvate metabolism
mpa00630  Glyoxylate and dicarboxylate metabolism
mpa00640  Propanoate metabolism
mpa00650  Butanoate metabolism
mpa00900  Terpenoid backbone biosynthesis
mpa01100  Metabolic pathways
mpa01110  Biosynthesis of secondary metabolites
mpa01120  Microbial metabolism in diverse environments
mpa01130  Biosynthesis of antibiotics
mpa01200  Carbon metabolism
mpa01212  Fatty acid metabolism
mpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP_1714 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    MAP_1714 (fadA)
   00640 Propanoate metabolism
    MAP_1714 (fadA)
   00650 Butanoate metabolism
    MAP_1714 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MAP_1714 (fadA)
   00072 Synthesis and degradation of ketone bodies
    MAP_1714 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP_1714 (fadA)
   00310 Lysine degradation
    MAP_1714 (fadA)
   00380 Tryptophan metabolism
    MAP_1714 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAP_1714 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP_1714 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MAP_1714 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpa04147]
    MAP_1714 (fadA)
Enzymes [BR:mpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAP_1714 (fadA)
Exosome [BR:mpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAP_1714 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAS04031
UniProt: Q73Z89
Position
1872259..1873470
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYEGIRTPRGKGRASGALHSVKPISLVVGLIDELRRRFPDLDEDRISDVVLGVVT
PVGDQGMDIARTAVTVAGLPDTVDGVQLNRFCGSGLDAVNVAAKAVRSGFDELVIAGGVE
SMSRVEMGSDRGAMAYDAATAYDNYFIPQGVAADLLATIEGYTREDVDAYAVRSQRRAAE
AWSGGYFAKSVVPVRDINGLTILDHDEHMRPDGTVEDLAKLTPAFAGIGEFGGFDAVAMQ
RYHWVEAINHVHTGGNSSGIVDGASLVLVGSEQAGAASGLTPRARIVSAATSGADPVLMF
GGPIPAVRKALDLAGLTIDDIDLFEMNEAFAAIAIKIQQYFGIPDQKYNVNGGAIAMGHP
LGATGAMLLGTVFDELERRGGRYGLITLCVAGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaggcatacatttacgagggaatccgcaccccgcggggcaagggcagagccagc
ggtgcgctgcattccgtgaagccgatctcgttggtggtcgggctgatcgacgagctgcgc
cgccgctttccggacctcgacgaggaccgcatctccgacgtcgtgctcggcgtcgtcacc
ccggtgggcgatcagggcatggacatcgcgcgcacggcggtcaccgtggccgggctgccc
gacaccgtggacggggtgcagctcaaccggttctgcgggtcgggcctggacgcggtcaac
gtcgcggcgaaggcggtgcgctcgggtttcgacgagttggtgatcgccggtggggtggag
tcgatgtcgcgggtcgagatgggcagcgaccgtggggcgatggcttacgacgcggcgacc
gcctacgacaactacttcatcccgcagggggtggccgccgacctgctggccaccatcgag
gggtacacccgcgaggacgtcgacgcctacgcggtgcgttcgcagcggcgcgccgccgag
gcgtggtcgggcggctacttcgcgaaatcggttgtgccggtgcgggatatcaacgggttg
accatcctggatcacgacgagcacatgcggccggacggcacggtggaggacctggccaag
ttgacgcccgcgttcgcgggcatcggcgaattcggtggcttcgacgccgtcgcgatgcag
cgctaccactgggtcgaagcgatcaaccacgtgcacaccggcggcaacagctcgggcatt
gtggacggcgcctcgctggtgctggtcggtagcgagcaggccggcgcggcatccggtctg
accccgcgggcgcgcatcgtgtccgcggccaccagcggcgccgacccggtgctgatgttc
ggcggcccaatcccggccgtgcgcaaagcacttgaccttgccggcctgaccatcgacgac
atcgacctgttcgagatgaacgaggccttcgcggccatcgccatcaagatccaacagtat
ttcggcatcccggaccagaagtacaacgtcaacggcggtgctatcgcgatgggtcatccc
ctcggcgccaccggcgccatgttgttgggcaccgttttcgacgagctggagcggcggggt
ggacgctacggcctgatcacgctgtgcgtcgccggcggcatgggcgtggcgaccatcatc
gaaagggtttga

DBGET integrated database retrieval system