KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_2163c
Entry
MAP_2163c         CDS       T00156                                 

Gene name
hrcA
Definition
(GenBank) HrcA
  KO
K03705  heat-inducible transcriptional repressor
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpa03000]
    MAP_2163c (hrcA)
Transcription factors [BR:mpa03000]
 Prokaryotic type
  Other transcription factors
   Others
    MAP_2163c (hrcA)
SSDB
Motif
Pfam: HrcA HTH_DeoR HTH_11 HrcA_DNA-bdg HTH_20
Other DBs
NCBI-ProteinID: AAS04480
UniProt: Q73XZ5
Position
complement(2395707..2396738)
AA seq 343 aa
MGSADERRFEVLRAIVADFVATKEPIGSKTLVERHNLGVSSATVRNDMAVLEAEGYITQP
HTSSGRVPTEKGYREFVDRLDDVKPLSAAERRAIQNFLESGVDLDDVLRRAVRLLAQLTR
QVAIVQYPTLSSSTVRHLEVIALTPARLLMVVITDSGRVDQRIVELGDVIDDHELSRLRE
MLGQALVGKKLSAASVAVADLAEQLRSPDGLGDAVGRSATVLLESLVEHSEERLLMGGTA
NLTRNAADFGGSLRSILEALEEQVVVLRLLAAQQEAGKVTVRIGHETAAEQMVGTSMVTT
AYGTSDTVYGGMGVLGPTRMDYPGTIASVAAVAMYIGEVLGAR
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtggggagtgccgatgagcgtcgcttcgaggtgctgcgcgccatcgtcgccgacttcgtc
gccaccaaggagccgatcggttccaagaccttggtggagcgtcataacctgggcgtgtcg
tcggctaccgtccgcaacgacatggcggtgctggaggccgagggctacatcacccagccg
cacaccagctccgggcgggtccccaccgagaagggctaccgcgaattcgtcgaccggctc
gacgacgtcaagccgctgtcggcggccgaacggcgcgcgatccagaacttcctggaatcg
ggtgtcgacctcgacgacgtgctgcgccgcgcggtgcggctgctggcgcagctgacccgg
caggtggccatcgtgcagtacccgacgttgtcgtcgtccaccgtgcggcacctcgaggtg
atcgccctgaccccggcgcggctgctgatggtcgtcatcaccgactccggccgggtggat
cagcgcatcgtcgaactcggcgacgtcatcgacgaccacgagctgtcccggctgcgcgag
atgctcgggcaggcattggtcggcaagaagctgtccgccgcgtcggtcgcggtggccgac
ctcgccgagcagctgcgcagccccgacggcctgggtgacgcggtgggccggtcggcgacg
gtgttgctggagtcgctggtcgaacacagcgaggaacgcctgctgatgggcggtaccgcc
aacctgacccgcaacgccgccgatttcggcggctcgttgcgttccatcctggaggcgctc
gaggagcaggtcgtggtgctgcggttgctggccgcccagcaggaggccggtaaggtgacg
gtgcgcatcggccacgagacggccgccgagcagatggtgggcacctcgatggtcaccacc
gcctacggcacctccgacaccgtttacgggggaatgggtgtgctggggcccacccggatg
gactatccgggaactatcgccagcgttgctgcggttgccatgtatatcggcgaagtcctg
ggtgctcgatga

DBGET integrated database retrieval system