KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_2671cHelp
Entry
MAP_2671c         CDS       T00156                                 

Gene name
zwf
Definition
(GenBank) Zwf
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00030  Pentose phosphate pathway
mpa00480  Glutathione metabolism
mpa01100  Metabolic pathways
mpa01110  Biosynthesis of secondary metabolites
mpa01120  Microbial metabolism in diverse environments
mpa01130  Biosynthesis of antibiotics
mpa01200  Carbon metabolism
Module
mpa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mpa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MAP_2671c (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MAP_2671c (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpa04147]
    MAP_2671c (zwf)
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     MAP_2671c (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     MAP_2671c (zwf)
Exosome [BR:mpa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MAP_2671c (zwf)
  Exosomal proteins of colorectal cancer cells
   MAP_2671c (zwf)
  Exosomal proteins of bladder cancer cells
   MAP_2671c (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N MT0933_antitox
Motif
Other DBs
NCBI-ProteinID: AAS04988
UniProt: Q73WI9
Structure
PDB: 

Position
complement(3008144..3009553)
Genome map
AA seq 469 aa AA seqDB search
MADDDSHPSDLLVIFGITGDLARKMTFRALYRLERREELEHPIIGVASDDITLDQLLDRA
REAIKATGETFDDAVFDRLAGRLSYLSGDVTDAGLYSELAKKIGGDSRPLYYLEMPPSLF
APIVENLAKADLLERARVAVEKPFGHDLESARDLNARLRAVLDEDQILRVDHFLGKQPVE
ELQYLRFANNALAKLWDRDSISEIHITMAEDFGIEDRGKFYDAVGAVRDVVQNHLLQVLA
LVAMEPPVGAGADDLNDKKAEVFRAMPSLDPEHCVRGQYRGYTEVPGVAKDSTTETYVAL
RAEIDNWRWAGVPIFLRAGKALPHKVTEVRMFLHHVPGFSFLPNRRPPEPNQIVLRIDPD
PGMRLQLSAQVGDSWHDVHLDSSFAVDLGEPVRPYERLLYAAFNGDRQLFAREDAIEETW
RIVQPVLDKPSRIHQYEQGSWGPEAAQALVHGRHAWQQPWLPQSTSTKR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgatgacagccatccatccgacctgctggtgatcttcggaatcaccggggac
ttggcgcgcaagatgacgttccgcgcgctctaccggctggagcgccgcgaggagctcgag
cacccgatcatcggcgtggccagcgacgacatcaccctcgaccagctgctggaccgcgcc
cgggaggcgatcaaggccaccggtgagacgttcgacgacgcggtgttcgaccgcttggcg
ggccggctgtcctacctgtcgggcgacgtcaccgacgccgggctctacagcgagctcgcc
aagaagatcggtggcgattcgcgtccgctgtactacctggagatgccgccgtcgttgttc
gcgccgatcgtggagaacctggccaaggccgacctactggaacgcgccagggtggcggtg
gaaaagccgttcggccacgacctggaatctgcgcgcgacctcaacgcccggctgcgcgcg
gtgctcgacgaagaccaaatcctgcgcgtagaccactttttgggcaaacagccggtcgaa
gaactgcaatacctgcggttcgccaacaacgccctggccaagctgtgggaccgcgacagc
atctccgaaatccacatcaccatggccgaggacttcggcatcgaggaccgcggcaagttc
tatgacgccgtgggggcggtgcgcgacgtcgtgcaaaaccatctgctgcaggtgctcgcg
ctggtcgccatggaacccccggtgggggcgggcgccgacgacctcaacgacaagaaggcc
gaggtgttccgggccatgccgtcgctggacccggagcactgcgtgcgtggccagtatcgc
ggctacaccgaagtccccggtgtggcaaaggattccaccaccgagacctacgtcgcgctg
agggccgagatcgacaactggcgctgggccggggtgccgatcttcctgcgcgccggcaag
gcgttgccgcacaaggtcaccgaggtccggatgttcctgcatcacgtgcccggcttctcc
ttcctgcccaaccgccgcccgcccgagcccaaccagatcgtgctgcgcatcgaccccgat
cccgggatgcgcctgcagctgtccgctcaggtcggcgactcgtggcacgacgtgcacctg
gactcctcgttcgcggtggacctcggcgaaccggtgcggccctacgaacggctgctctac
gccgcgttcaacggcgaccgccagctgtttgcccgcgaggacgccatcgaagagacctgg
cggatcgtgcagccggtgctggacaagccgagccgcatccaccaatacgagcaaggctcc
tggggacccgaggccgcgcaggcgctggtgcacggtcgccacgcctggcagcaaccgtgg
ctgccgcagagcacgtccacgaaacgataa

DBGET integrated database retrieval system