KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_3069Help
Entry
MAP_3069          CDS       T00156                                 

Gene name
idsA2
Definition
(GenBank) IdsA2_2
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00900  Terpenoid backbone biosynthesis
mpa01100  Metabolic pathways
mpa01110  Biosynthesis of secondary metabolites
mpa01130  Biosynthesis of antibiotics
Module
mpa_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAP_3069 (idsA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mpa01006]
    MAP_3069 (idsA2)
Enzymes [BR:mpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     MAP_3069 (idsA2)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     MAP_3069 (idsA2)
    2.5.1.29  geranylgeranyl diphosphate synthase
     MAP_3069 (idsA2)
Prenyltransferases [BR:mpa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   MAP_3069 (idsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AAS05617
UniProt: Q73VE5
Position
3414585..3415733
Genome map
AA seq 382 aa AA seqDB search
MPSGRERWDTMGALSFSPTTTAAAPAWTRIDDFGGWRAHVRAMVLDEVADFVGMRRADEL
DRAGIGTAGDILVQFVSGGKCLRSTFVYLGWLCGAPRDRAALRAAASFELLHAFALLQDD
VMDGAQERRGRPAAHLQFGRWHQDRGLSGSPRRFGESAAILLGDLCLIWAEQMLRDSGLE
ARRLQRAWPRYDAMRVELAVGQFADLTNDIRQSPGLDAVLEVARRKSGNYTVRRPLEIGA
TMAGCDDRTVARLSRYGAAVGEAFQLRDDVLGVFGSPAVTGKPCAADLFERKATAVVVSA
HQLADPPVRRELIELATRDVLDAAAIERWKALIVETGAVRLIERMISDRVASAREQLCGL
PVDESVRAALAEMAAVCTDRAE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtccgggagggagcgctgggacaccatgggagctttgtcgttttcgcccaccacc
acggcggcggcgccggcctggacgcgcatcgacgacttcggcgggtggcgggcacacgtt
cgggcgatggtgttggacgaggtcgccgacttcgtcggaatgcgacgcgccgacgaactc
gaccgggcggggatcgggaccgcgggcgacatcctggttcagttcgtctccggcggcaag
tgcctgcggtcgacgttcgtctacctgggctggctgtgtggggcaccgcgcgaccgggcg
gcgctgcgggccgccgccagtttcgagctgctgcacgccttcgcactgctgcaagacgat
gtgatggacggtgcgcaggaacggcggggccgtccggccgcgcatctgcagttcggccgc
tggcatcaagaccgcggattgtccggctcgccacggcgattcggtgaatcggccgccatc
ctgttgggcgatctctgcctgatctgggccgaacagatgctgcgcgacagcggactcgaa
gcgcgccgcctgcaacgcgcgtggccgcgctatgacgccatgcgcgtcgagctcgcggtg
ggccagttcgccgacctgaccaacgacatccggcagtcaccggggctggacgccgtgctg
gaggtggcgcgccgcaaatcgggtaactacacggtgcgccggccgctggaaatcggcgcg
acgatggccgggtgcgacgaccggacggtggcccggctgagccgctacggcgcggcggtg
ggtgaagccttccagctgcgcgacgacgtgctgggcgtcttcggctcgccggcggtcacc
gggaagccctgcgccgcagatctgttcgagcgcaaggccaccgccgtggtggtgagcgcc
caccaactcgccgatccgccggtccggcgtgagctcatcgagctcgccactcgtgacgtg
ctggacgcggccgcgatcgagaggtggaaagcgctgatcgtcgagaccggagcggtgcgg
ctgatcgagcggatgatcagcgaccgcgtcgcgtcggcacgcgagcagctgtgcggcctg
cccgtcgacgaatcggtgcgcgccgcgctggccgagatggcggccgtctgtacggatcgc
gccgaatga

DBGET integrated database retrieval system