KEGG   Mycobacterium paragordonae: C0J29_00630
Entry
C0J29_00630       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_00630
   00650 Butanoate metabolism
    C0J29_00630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_00630
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_00630
   00310 Lysine degradation
    C0J29_00630
   00360 Phenylalanine metabolism
    C0J29_00630
   00380 Tryptophan metabolism
    C0J29_00630
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_00630
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_00630
   00281 Geraniol degradation
    C0J29_00630
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_00630
   00627 Aminobenzoate degradation
    C0J29_00630
   00930 Caprolactam degradation
    C0J29_00630
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_00630
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE93535
UniProt: A0A386TZD0
Position
126463..127212
AA seq 249 aa
MIGLERDGGVLTVRIQRPERRNALNAAVIDELRATFEGAAAEGVKAIVLTGAGSVFCSGM
DLSGAAAASAENLIDELMDKAIALNAAIDHTPVPVIAAINGPVIGAGVQLAIICDLRVVD
PNAYFQLPVAKYGLAADTWTVRRLTSLVGYGRARAMLMAAQKLPADEALLCGMANRVGTL
EDALQWAHEIAGLAPLSLQHAKRVLNDDGAWDTERPVHQDMFEAAWKSQDAVEAQVARFQ
KRSPVFQGR
NT seq 750 nt   +upstreamnt  +downstreamnt
gtgatcggactcgagcgggacggcggtgtgctgacggttcgaatacagcgcccggaacgg
cgcaacgccctcaacgccgcggtgatcgatgaactccgggcgaccttcgaaggcgccgcg
gcggagggcgtgaaggccatcgtcctgaccggcgcgggcagcgtcttctgttccggaatg
gacctgtcgggggcggcggccgcgtcggcggagaacctcatcgatgaactgatggacaag
gccatcgcactcaacgcagcgatcgaccacacaccggtgccggtgatcgccgccatcaac
ggtccggtgatcggggccggcgtgcaactggccatcatctgcgacctgcgcgtggtggat
ccgaacgcgtattttcaactgccagtagccaaatacgggctggcggcggatacctggacg
gtccggcggctcacctcgctggtgggttacgggcgcgcccgcgccatgctgatggcggct
cagaaacttcccgccgacgaggcgctgttgtgcggaatggcgaaccgggtaggcaccctc
gaggatgccctgcagtgggcgcacgagatcgcgggactggctccgctgtcgctacagcac
gccaagcgggtgctcaacgacgacggtgcctgggacaccgagagacccgtccatcaagac
atgttcgaggcggcgtggaaaagccaggacgccgtcgaggcgcaggtggcccgctttcag
aagcggtcaccggtgtttcagggtcgctga

KEGG   Mycobacterium paragordonae: C0J29_00895
Entry
C0J29_00895       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_00895
   00650 Butanoate metabolism
    C0J29_00895
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_00895
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_00895
   00310 Lysine degradation
    C0J29_00895
   00360 Phenylalanine metabolism
    C0J29_00895
   00380 Tryptophan metabolism
    C0J29_00895
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_00895
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_00895
   00281 Geraniol degradation
    C0J29_00895
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_00895
   00627 Aminobenzoate degradation
    C0J29_00895
   00930 Caprolactam degradation
    C0J29_00895
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_00895
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE93578
UniProt: A0A386TZP9
Position
188167..188976
AA seq 269 aa
MAEPAVLLERDQHILTITLNRPEKRNAFNPEVLCRLADAWDLLDDDPDLRVAILTGAAGN
FSAGADLDRLVGALIAGDPPQNEYEERVRSDFSLIYKGFLKDHYVKKPIIAAVEGYCYAG
GMEILQAFDIRVAADNAQLAISEVQRGLFPMSASTIRLPRQIPYTVAMEMLIAGTPISGQ
RAYEVGLVGHVTAAGGALDRAREIARQVAANGPLAVRNIKASVIENLEKTEAEAFPRELE
LGMAVMASADAKEGPRAFLEKRPPKFTGT
NT seq 810 nt   +upstreamnt  +downstreamnt
gtggcagaaccggcagtcctcctcgagcgggaccagcacatcctcaccatcaccctcaac
cgccccgagaaacgcaacgccttcaatccagaagtcctgtgccggctcgccgacgcctgg
gatcttctggacgacgacccggacctccgggtcgcgatcctgactggagcggccggcaac
ttctccgccggagcagatctggaccggttggtgggcgccctgatcgccggcgatcctccg
cagaatgagtatgaggagcgggtcaggtccgatttctcgttgatttacaagggttttctg
aaggaccactacgtgaagaagccgatcatcgccgcggtggagggctactgctacgcgggc
gggatggagatcctgcaggccttcgatatcagggtggccgccgacaacgctcagttggcg
atcagcgaagtgcagcgcgggctgtttccgatgagcgcatcaacgattcgcttgccgcgc
cagatcccctacaccgtcgcgatggaaatgctgatcgcgggcaccccgatttccgggcaa
cgcgcctacgaggtcggcctggtcggacacgtcaccgccgccgggggtgcgctggaccgg
gctcgggagatagcgcggcaagtggcggcgaacggtccgctggccgtgcggaacatcaag
gcatcggtgatcgaaaacctggaaaagaccgaggccgaggcttttccgcgagaactcgaa
ctcggcatggcagtgatggcatcggcggacgcgaaggaggggccgcgcgcgttcctggag
aagcggcccccgaaattcaccggtacgtaa

KEGG   Mycobacterium paragordonae: C0J29_01200
Entry
C0J29_01200       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_01200
   00650 Butanoate metabolism
    C0J29_01200
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_01200
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_01200
   00310 Lysine degradation
    C0J29_01200
   00360 Phenylalanine metabolism
    C0J29_01200
   00380 Tryptophan metabolism
    C0J29_01200
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_01200
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_01200
   00281 Geraniol degradation
    C0J29_01200
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_01200
   00627 Aminobenzoate degradation
    C0J29_01200
   00930 Caprolactam degradation
    C0J29_01200
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_01200
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: AYE93628
UniProt: A0A386TZU9
Position
258742..259590
AA seq 282 aa
MTVPHQPDVVTYSVTDDLALVTMNRPRYRNAQNSVMTYALDAAFRRAVEDDAVKVIVLAG
SGEHFSAGHDIGSPGRDHHVRYDNEAVLWWDHVAKSGGDQRFAREMEVYLGMCRRWREMP
KPVIAMVQGACIAGGLMLAWVCDLIVASTDAFFSDPVVRMGIPGAEYFAHPWVLGSRFAK
EILYTGDRFTAQRAYEVGMVNRVVPREHLERETFALAARIAKMPRFGLALAKKAVNQCED
QMGMRNGIDAVFGLHHFAHAHNAEVGAGPLGGVDVKDMARER
NT seq 849 nt   +upstreamnt  +downstreamnt
ttgacggttccccaccagccagacgtcgtaacctattccgtgacagatgatttggccctg
gtgacgatgaatcgcccccgatatcgcaatgcccagaattcggtgatgacgtacgctctc
gacgccgcgttccggcgagccgtggaggatgatgcggtcaaggtgatagtcctcgccggt
agcggtgagcacttcagcgccggacatgacatcggttcaccgggccgggatcaccatgtg
cgttatgacaacgaagcggtgctttggtgggaccacgtggccaaatcagggggagaccag
cgcttcgcccgggaaatggaggtttacctgggcatgtgccggcgttggcgggagatgccg
aagccggtgattgcgatggtgcagggtgcctgcatcgcgggcggattgatgcttgcgtgg
gtgtgcgatctgatcgtggcgtcgacagatgcgttcttctccgacccggtcgtgcgcatg
gggatcccgggcgccgagtacttcgcacatccgtgggtgctcggatcccggttcgcgaag
gaaatcctctacacgggtgatcgattcacggcgcagcgcgcctacgaggtgggcatggtg
aaccgggtggttccgcgcgagcacctggagcgggagacctttgccctcgcagcacgcatc
gcgaagatgccccggttcggtcttgcgctcgccaagaaagcggtgaatcagtgtgaagac
cagatgggtatgcggaacggaatcgatgcggtgttcggactacatcatttcgcgcacgcc
cacaacgccgaggtgggggcaggtccgttgggcggggtagacgtgaaagacatggcgcgc
gaacgatga

KEGG   Mycobacterium paragordonae: C0J29_02625
Entry
C0J29_02625       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_02625
   00650 Butanoate metabolism
    C0J29_02625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_02625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_02625
   00310 Lysine degradation
    C0J29_02625
   00360 Phenylalanine metabolism
    C0J29_02625
   00380 Tryptophan metabolism
    C0J29_02625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_02625
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_02625
   00281 Geraniol degradation
    C0J29_02625
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_02625
   00627 Aminobenzoate degradation
    C0J29_02625
   00930 Caprolactam degradation
    C0J29_02625
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_02625
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: AYE93849
UniProt: A0A386U0I5
Position
576260..577039
AA seq 259 aa
MSDEANTEPEVLTEKRDRILIITINRPKAKNAINAAASQGLADAMDRLDDDADLSVAILT
GAGGSFCAGMDLKAFARGENVAIQGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDL
IVAANNSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDQLSAARAHELGLVNV
LAEPGGALDAAIALAEKITANGPLAVAATKRIITESRGWTLENRFTKQIEILAPIFMSND
AKEGAIAFAEKRPPRWTGT
NT seq 780 nt   +upstreamnt  +downstreamnt
gtgagcgacgaagctaacaccgaacccgaggtcctgactgaaaagcgggaccggatcctg
atcatcaccatcaaccggcccaaggccaagaacgcgatcaatgccgcggccagccagggc
ctggccgacgccatggatcgcctggacgacgacgccgatctctcggtggccatcctgacc
ggcgccggcggatccttctgcgcgggcatggacctcaaggcgttcgcccgcggcgagaac
gtcgcgatccagggcaggggcctggggttcaccgagcgcccacccgccaagccgctgatc
gccgcggtcgagggttacgccctggccggtggcaccgaactggccctggctacggatctg
attgtggcagccaacaattcggcgttcggcatccccgaggtcaagcgcggcctggtggcc
ggcggcggtggcttgctgcggctgcccgagcgcatcccgtacgcgatcgcgatggagctg
gccctgaccggcgaccagctgtccgccgcacgcgctcacgaactgggcctggtcaacgtg
ctcgccgaacccggcggggcactggacgcggcgatcgcgctggccgagaagatcaccgcc
aacggcccgcttgcggtggccgccaccaagcgcatcatcaccgaatcccggggctggacg
ctggaaaaccggttcaccaagcagatcgagattctcgcgccgatcttcatgtccaacgac
gcgaaagagggcgcgatcgccttcgccgagaagcgcccgccgcgctggactggcacataa

KEGG   Mycobacterium paragordonae: C0J29_02660
Entry
C0J29_02660       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_02660
   00650 Butanoate metabolism
    C0J29_02660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_02660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_02660
   00310 Lysine degradation
    C0J29_02660
   00360 Phenylalanine metabolism
    C0J29_02660
   00380 Tryptophan metabolism
    C0J29_02660
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_02660
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_02660
   00281 Geraniol degradation
    C0J29_02660
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_02660
   00627 Aminobenzoate degradation
    C0J29_02660
   00930 Caprolactam degradation
    C0J29_02660
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_02660
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE93855
UniProt: A0A386U0B8
Position
585127..585909
AA seq 260 aa
MTNTVSLERDGHVLLIGLNRPHKRNSFDREMLADLSRAYAVLESDPDMRAGVLFAHGDHF
TAGLDLVDVGPGIASGESPVPEGGRDPWRLDGAWTTPLVAVAQGWCMTLGIELLLAADIR
IAAAGTRFTQLEVQRGIYPFGGATIRLPREAGWGNAMRWLLTGDEFDAAEAHRIGLVQEV
AEDGAAALARAREIAQTIAERAAPLGVQATLASAHLARERGEAAAIERLRPDVAALFASE
DAAEGVQSFVERRQARFSGR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaccaacacggtgtccctggagcgggacggacatgtactgctgatcggcctgaaccgg
ccccacaagcgcaactcgttcgatcgggagatgctcgccgacctgtcccgcgcctacgcg
gtcctggaatcggaccccgacatgcgggctggtgtgctcttcgcccacggtgaccacttc
accgccggactggacctggtcgatgtcggtcccggcatcgcctcaggcgaatcgccggtg
cccgaggggggacgggacccgtggcgtctggacggcgcctggactacgccgttggtcgcc
gttgcgcagggctggtgcatgacgctcggtatcgaactgctgctggctgccgacatccgg
atcgcggcggccggaacccgtttcacgcagctggaggtgcagcgcggcatctacccgttc
ggcggcgcgacgatccggctgcctcgcgaggcgggctgggggaatgccatgcgctggctg
ctgaccggcgacgagttcgacgccgccgaggcgcaccggatcggcttggtgcaggaggtc
gccgaggacggcgcggcggcgctggcccgggcccgcgagatcgcgcagaccatcgccgag
cgcgccgcgccactgggcgtgcaggccacgctggcttctgcgcacctggcccgcgagcgg
ggagaggcggcggcgatcgagcggttgcgccccgacgtcgcggcgttgttcgccagcgag
gacgccgccgagggtgtgcagtcgttcgtcgaacgacggcaggccaggttcagcggacgc
tga

KEGG   Mycobacterium paragordonae: C0J29_04310
Entry
C0J29_04310       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_04310
   00650 Butanoate metabolism
    C0J29_04310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_04310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_04310
   00310 Lysine degradation
    C0J29_04310
   00360 Phenylalanine metabolism
    C0J29_04310
   00380 Tryptophan metabolism
    C0J29_04310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_04310
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_04310
   00281 Geraniol degradation
    C0J29_04310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_04310
   00627 Aminobenzoate degradation
    C0J29_04310
   00930 Caprolactam degradation
    C0J29_04310
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_04310
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE94126
UniProt: A0A386U0T5
Position
complement(948094..949038)
AA seq 314 aa
MPSSEPSPAPSAGPEFETLLYSSSGPVATITLNRPEHLNTIVPPMPDEIEAAIGLAERDH
DIKVIVLRGAGRAFSGGFDFGGGFQHWGEDMMTEGRWDPGKDFAMVSARETAPTQKFMAI
WRASKPVIAQVHGWCVGGASDYALCADIVIASEDAVIGTPYSRMWGAYLTGMWLYRLSLA
KVKWHSLTGRPLTGVQAAEIELINEAVPFERLEARVAEIAAELAQIPLSQLRAQKLIVNQ
AYENMGLASTQLLGGILDGLMRNTPDALDFIRTAETQGVRAAVERRDGPFGDYSQAPPEL
RPNPSHVIVPDRDG
NT seq 945 nt   +upstreamnt  +downstreamnt
atgccttcttccgagccttctcccgccccttctgccgggcccgaattcgagacgctgctg
tattccagcagtggcccggtggccaccatcaccctcaaccgtcccgagcacctgaacacg
atcgtgccgcccatgcccgacgagatcgaagccgccatcgggctggccgagcgcgaccac
gacatcaaggtcatcgtgctgcgcggcgccgggcgcgccttctccggcggcttcgacttc
ggcggcggcttccagcactggggcgaggacatgatgactgagggccggtgggatccgggc
aaggatttcgcgatggtcagcgcacgcgagaccgcgccgacgcagaagttcatggccatc
tggcgggcgtccaagccggtgatcgcgcaggtgcacggctggtgcgtcggcggggccagc
gactacgccctgtgcgccgacatcgtgatcgccagcgaggacgcggtgatcggcaccccg
tacagcaggatgtggggcgcctacctgaccggcatgtggctgtaccggctcagcctggcc
aaagtgaaatggcactccttgaccggccggccgctgacgggtgtgcaggccgccgagatc
gaactgatcaacgaagcggtcccgttcgagcggctggaggcccgggtcgccgagatcgcg
gccgagttggcgcagatcccgttgtcgcagctgcgggcgcagaagctgatcgtcaaccag
gcttacgagaacatgggcctggcgtccacccagctgctgggcggcatcctcgacggcctg
atgcgcaacacccccgatgcgctcgacttcatccgcaccgccgagacgcagggcgtccgg
gccgcggtggagcgccgggacggcccgttcggcgactacagccaggctcccccggagctg
cggccgaacccgtcacacgtgatagttcctgatcgcgatgggtag

KEGG   Mycobacterium paragordonae: C0J29_05265
Entry
C0J29_05265       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_05265
   00650 Butanoate metabolism
    C0J29_05265
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_05265
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_05265
   00310 Lysine degradation
    C0J29_05265
   00360 Phenylalanine metabolism
    C0J29_05265
   00380 Tryptophan metabolism
    C0J29_05265
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_05265
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_05265
   00281 Geraniol degradation
    C0J29_05265
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_05265
   00627 Aminobenzoate degradation
    C0J29_05265
   00930 Caprolactam degradation
    C0J29_05265
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_05265
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 CLP_protease BrkDBD
Other DBs
NCBI-ProteinID: AYE94290
UniProt: A0A386U170
Position
complement(1139636..1140331)
AA seq 231 aa
MSGPVVYTHDETIGVIRMDDGKVNALGPTMQQALNDALDQADADNVGALVITGNQRVFSG
GFDLKILTSGEVQPAIDMLRGGFELSYRLLSYPKPVVIACTGPAIAMGSFLLCSGDHRIA
AHAYNIQANEVAIGMVIPWAALEVLKLRLTQSAYQQATGLAKTFFGETALAAGFIDEMAL
PDRVIARAEEAAHEFAGLNQSAHAATKLRARADALKAIRAGIDNIEKEFGV
NT seq 696 nt   +upstreamnt  +downstreamnt
atgagcggtccggtcgtctacacccacgacgaaaccatcggggtcattcggatggacgac
ggcaaagtcaacgcgttggggccgaccatgcagcaggccctcaacgacgcgctcgaccag
gccgacgccgacaatgtcggggcgctggtgatcaccgggaaccagcgggtgttcagcggt
ggattcgacctgaagattctgacctcgggcgaggtgcagcccgcgatcgacatgctgcgc
ggcgggttcgagctgtcctaccggctgctgtcctacccgaagccggtggtgatcgcgtgc
accggtcccgcgatcgcgatgggttcgttcctgctgtgctcgggggatcaccgaattgcc
gcccacgcgtacaacattcaggccaacgaggtcgcgatcgggatggtgattccctgggcg
gcgctggaggtcctgaaactccggctgacgcaatcggcctaccaacaggccaccggcctg
gccaagacgttcttcggtgagacggcgcttgccgccggcttcatcgacgaaatggcactg
ccggaccgagtgatcgcccgcgctgaagaggcggcgcacgaattcgccggcctcaatcag
tcggcgcatgcggcgaccaaactgcgcgcccgcgccgatgcgctcaaggcgatccgcgcc
gggatcgacaacatcgagaaggaattcggcgtctaa

KEGG   Mycobacterium paragordonae: C0J29_05475
Entry
C0J29_05475       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_05475
   00650 Butanoate metabolism
    C0J29_05475
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_05475
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_05475
   00310 Lysine degradation
    C0J29_05475
   00360 Phenylalanine metabolism
    C0J29_05475
   00380 Tryptophan metabolism
    C0J29_05475
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_05475
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_05475
   00281 Geraniol degradation
    C0J29_05475
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_05475
   00627 Aminobenzoate degradation
    C0J29_05475
   00930 Caprolactam degradation
    C0J29_05475
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_05475
SSDB
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C DUF3756
Other DBs
NCBI-ProteinID: AYE94323
UniProt: A0A386U1E7
Position
1183133..1184071
AA seq 312 aa
MTHSIRPVDFNNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALVERADLDPDVH
VILVSGRGEGFCAGFDLSAYADRTGSAGQEGGYHGTVLDGKTQAVNHLPNQPWDPMIDYQ
MMSRFVRGFSSLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPDPADLDDRTERLVARIAALPV
NQLIMIKLALNAPLLQQGVASSRMVSTVFDGVARHTPEGHAFVADAVEHGFRDAVKHRDE
PFGDYGRRASQV
NT seq 939 nt   +upstreamnt  +downstreamnt
gtgacccactcgatcaggccggtcgacttcaacaacctgaaaacgatgacctacgaggtc
accgaccgggttgcgcgcatcaccttcaaccggccggagaaaggcaacgccatcgtcgcc
gacaccccgctggagctttcagcgctggtggaacgcgccgacctggatcctgacgtccac
gtcattctggtctccggccgcggtgaaggcttctgcgccggtttcgatctgtccgcctac
gccgaccggaccggctccgcgggccaggaaggcggctaccacggcacggtgctggacggg
aagacgcaggcggtcaaccacctgccgaaccagccgtgggacccgatgatcgactatcag
atgatgagccggttcgtccgcggcttctcctccctgatgcacgccgacaagccgacggtg
gtgaagatccacggctactgcgtggccggcggcaccgacatcgcactgcacgccgatcag
gtgatcgcggccgccgacgcgaagatcggctatccgccgacccgggtctggggtgtgccg
gcagcgggcttgtgggcgcaccgactgggcgaccagcgtgccaagcgcctgctgttcacc
ggtgactgcatcaccggcgcgcaggcggccgagtggggcctggcagtggaggcacccgat
cccgccgatctcgacgaccgcaccgagcggctggtggccaggatcgccgcgctgccggtg
aaccagctgatcatgatcaagctcgcgctcaatgccccgctgctgcagcagggcgtcgcg
tccagtcggatggtcagcacggtgttcgatggggtggcgcggcacacgccggagggacac
gcgttcgtcgccgacgcggtcgagcacggcttccgggatgcggtcaagcaccgcgacgag
cctttcggcgattacggccgccgagcttcccaggtgtag

KEGG   Mycobacterium paragordonae: C0J29_05485
Entry
C0J29_05485       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_05485
   00650 Butanoate metabolism
    C0J29_05485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_05485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_05485
   00310 Lysine degradation
    C0J29_05485
   00360 Phenylalanine metabolism
    C0J29_05485
   00380 Tryptophan metabolism
    C0J29_05485
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_05485
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_05485
   00281 Geraniol degradation
    C0J29_05485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_05485
   00627 Aminobenzoate degradation
    C0J29_05485
   00930 Caprolactam degradation
    C0J29_05485
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_05485
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: AYE94324
UniProt: A0A386U1D4
Position
1184805..1185572
AA seq 255 aa
MSDLVRVERDGPVTTVCINRPGARNAVNGPTAAALYTAFETFDRDDTASVAVLCGEGGTF
CAGADLKAFGTPQANSVHRTGPGPMGPSRMMLSKPVIAAVDGYAVAGGLELALWCDLRVA
EEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVKADEALAIGLANRVVP
KGQARQAAQELAAELAALPQQCLRSDRLSALHQWGLPESAAMDLEFASISRVAAEALEGA
GRFAGGAGRHGAPAG
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagcgatttggtgcgggtggagcgcgacggcccggtgaccacggtctgcatcaaccgg
cccggggcgcgcaacgccgtcaacggcccgacggcggccgcgctgtacaccgccttcgaa
accttcgaccgcgacgacaccgcgtcggtggcggtgttatgcggtgagggcggaaccttt
tgcgcgggagccgatttgaaggccttcggcacaccgcaggcgaactccgtgcaccgcacc
ggcccgggcccgatggggccgtcgcggatgatgctctccaaaccggtgatcgcggcggtc
gacggttatgcggtcgccggcggcctcgagctcgcgttgtggtgcgatctgcgggtcgcc
gaggaagacgccgtattcggggtgttctgccggcgctggggagtgccgctcatcgacggt
ggaacggtgcggttgccgcgcctgatcgggcacagccgggcgatggacatgattctcacc
ggtcgtggcgtcaaggccgacgaggcgctggcgatcgggctggccaaccgggtggtgccc
aaagggcaagcgcgccaggccgcccaggagttggcggccgagcttgccgcgctgccacag
caatgcctgcggtcggaccggctgtcggcgctgcaccagtggggcctgcccgagtccgcg
gcgatggacctcgagttcgccagcatctcccgggtggccgccgaggcgctggagggggcg
gggcgctttgccggcggcgccggccggcacggcgccccggcgggttag

KEGG   Mycobacterium paragordonae: C0J29_07960
Entry
C0J29_07960       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_07960
   00650 Butanoate metabolism
    C0J29_07960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_07960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_07960
   00310 Lysine degradation
    C0J29_07960
   00360 Phenylalanine metabolism
    C0J29_07960
   00380 Tryptophan metabolism
    C0J29_07960
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_07960
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_07960
   00281 Geraniol degradation
    C0J29_07960
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_07960
   00627 Aminobenzoate degradation
    C0J29_07960
   00930 Caprolactam degradation
    C0J29_07960
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_07960
SSDB
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Other DBs
NCBI-ProteinID: AYE94719
UniProt: A0A386U316
Position
1710894..1711724
AA seq 276 aa
MSQAQTPPAPRPPEGDWLGTPFLRFTREGAFGVCTLDRPEARNAMTPAMYFGIKYAVNHV
GSDPDLAGLLITGTGDVFAPGGDMGGGGADNWLTFGAALGMDALPFDTLRQSAKPVVAAV
NGLCQGGGLQIALCADMAVVSDRATFRVPELYRGIGDTYYSQMLARLIGPVRTRDLMFTG
RTLSAPEALDWGMVARVVPHDELAGAAREVLAQCCRTAPGARTVIKSSLDNYLGLYDRIG
MQSSLGAPESIEGFMAFKERRSPSWVHPSLRIEGRL
NT seq 831 nt   +upstreamnt  +downstreamnt
atgagccaggcgcaaacaccaccagcaccccgaccgcccgagggcgactggctcggaaca
ccgttcctgcggttcacccgcgagggcgcattcggagtctgcaccctggaccgaccggaa
gcgcgcaacgcgatgacgccggcgatgtacttcggcatcaagtacgcggtgaatcatgtc
ggcagcgaccccgatctggcggggttgctcatcaccggcaccggagacgtcttcgcgccc
ggcggtgacatgggcgggggcggtgccgacaactggctgactttcggcgcggcgctcggc
atggacgccctgcccttcgacaccctgcgccaatccgccaagccggtggtcgccgcggtc
aacgggctctgccagggcgggggactgcaaatcgcgctgtgcgccgacatggccgtcgtc
agcgaccgcgccaccttccgggtgcccgagctctaccgcggcatcggcgacacctactac
agccagatgctggcccggctgatcggcccggtccgcacccgcgacctgatgttcaccgga
cgcaccctctcggcgccggaggcgctggattgggggatggtggcgcgcgtcgtcccgcac
gacgagttggccggggcggcaagggaagtgcttgcgcagtgctgccggaccgctccgggc
gcccgcacggtgatcaagtccagcctggacaactacctcggcctgtacgaccggatcggc
atgcagtccagtctcggcgccccagaatcgatcgaaggcttcatggctttcaaggaacgc
cgatcgcccagctgggtgcacccctcattgagaatcgaggggcggctctag

KEGG   Mycobacterium paragordonae: C0J29_09620
Entry
C0J29_09620       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_09620
   00650 Butanoate metabolism
    C0J29_09620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_09620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_09620
   00310 Lysine degradation
    C0J29_09620
   00360 Phenylalanine metabolism
    C0J29_09620
   00380 Tryptophan metabolism
    C0J29_09620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_09620
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_09620
   00281 Geraniol degradation
    C0J29_09620
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_09620
   00627 Aminobenzoate degradation
    C0J29_09620
   00930 Caprolactam degradation
    C0J29_09620
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_09620
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE98704
UniProt: A0A386UDF5
Position
2053531..2054298
AA seq 255 aa
MSEFVSVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREIAAAAEELGRRDDVAVVILFGG
HEIFSAGDDMPELRTLDPDEAGIAARVRREAVDAVAAIPKPTVAAITGYALGAGLTLALA
ADWRVSGDNVKFGATEILAGLVPGGDGMARLTRAVGPSRAKELVYSGRFFDAEEALALGL
IDDMVAPDNVYDAAATWARRFLDGPRPALAAAKAGINAVYEAPADRERHAAEDRRYVEVF
AAGQDAAAKGDSDGG
NT seq 768 nt   +upstreamnt  +downstreamnt
ttgagcgagttcgtgagcgtcgtggtgagcgacggctcccaggacgcgggcctggccatg
ctgttgctgtcccggccgcccaccaacgcgatgacccggcaggtctatcgggagatcgct
gccgcggccgaggaattgggccgccgcgacgacgtcgcggtggtgatcctgttcggcggc
cacgagatcttctccgccggcgacgacatgcccgaactgcgaaccctcgacccggacgag
gccggcatcgcggcccgggtacgccgcgaggccgtcgacgcggtggcggcgatcccgaag
cccaccgtcgccgccatcaccggatatgccctgggtgccgggctgacgctggcgctggcc
gccgactggcgggtcagcggcgacaacgtgaagttcggcgccaccgagatcctggccggc
ctggtgcccggcggcgacggcatggctcgcctgacccgcgcggtcgggccgagcagggcc
aaagaactggtgtacagcggccggttcttcgacgccgaggaagcgctggcgctcggcctg
atcgacgacatggtggccccggacaacgtctacgacgccgcggcgacgtgggccaggcgc
ttcctggacggtccgcggccggccctggccgccgccaaagcaggaatcaacgcggtgtac
gaggcgcccgcggaccgggagcgccacgctgccgaagaccgccgctacgtcgaggtgttc
gccgctggtcaggacgctgccgcgaaaggtgacagcgacggcggttag

KEGG   Mycobacterium paragordonae: C0J29_10970
Entry
C0J29_10970       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_10970
   00650 Butanoate metabolism
    C0J29_10970
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_10970
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_10970
   00310 Lysine degradation
    C0J29_10970
   00360 Phenylalanine metabolism
    C0J29_10970
   00380 Tryptophan metabolism
    C0J29_10970
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_10970
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_10970
   00281 Geraniol degradation
    C0J29_10970
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_10970
   00627 Aminobenzoate degradation
    C0J29_10970
   00930 Caprolactam degradation
    C0J29_10970
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_10970
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE95231
UniProt: A0A386U4Q2
Position
complement(2363085..2363834)
AA seq 249 aa
MTDEILLIDTDERVRTLTLNRPQSRNALSAALRDQFFGALAEAETDDGVDVIIVTGADPV
FCAGLDLKELGGQTALPDISPRWPALTKPVIGAINGAAVTGGLELALYCDILIASEHARF
ADTHARVGLLPTWGLSVRLPQKVGVGLARRMSMTGDYLSAADALRAGLVTEVVAHDQLLP
AARGVAASIVGNNQDAVRALLASYHHIDDAQIGGGLWLEAAAARKFRTSGDDIAANREAV
LQRGRSQVR
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaccgacgagatcctgctgatcgacaccgacgagcgggtgcgcaccctgacactgaac
cgtccgcagtcccgcaacgcgctctccgccgcgctgcgcgaccagttcttcggagctctg
gccgaagccgagaccgacgatggcgtggacgtcatcatcgtcaccggcgccgacccggtg
ttctgcgctgggctggacctcaaggagctgggcgggcagaccgccctccccgacatctcg
ccacggtggccggccctgaccaaaccggtgatcggcgccatcaacggagccgcggtcacc
ggcggactcgagctcgcgctgtactgcgacattctgatcgcctccgagcatgctcgcttc
gccgacacgcacgcccgggtcggtctgctgcccacctgggggctgagcgtgcggctgccg
cagaaggtcggcgtcggcctggcccgccggatgagcatgaccggggactacctctcggcg
gccgacgcactgcgcgccgggctggtcaccgaggtggtggcccacgaccaactgctgccc
gccgcccgcggtgtcgcggcctccatcgtcggcaacaatcaggatgcggtgcgcgcactg
ctggcgtcgtaccaccacatcgacgacgcccagatcggcggcggcctgtggctggaagcc
gctgcggcacggaagttccgcaccagcggcgacgacatcgcggccaaccgtgaggcggtg
ctgcagcgcggacgttcgcaggtgcgttga

KEGG   Mycobacterium paragordonae: C0J29_11610
Entry
C0J29_11610       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_11610
   00650 Butanoate metabolism
    C0J29_11610
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_11610
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_11610
   00310 Lysine degradation
    C0J29_11610
   00360 Phenylalanine metabolism
    C0J29_11610
   00380 Tryptophan metabolism
    C0J29_11610
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_11610
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_11610
   00281 Geraniol degradation
    C0J29_11610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_11610
   00627 Aminobenzoate degradation
    C0J29_11610
   00930 Caprolactam degradation
    C0J29_11610
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_11610
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE95341
UniProt: A0A386U513
Position
complement(2493566..2494372)
AA seq 268 aa
MPATYDDFPSLRCERGDNGILNLVLDAPGLNSVGPQMHRDLADVWPVINRYPDVKVVLVR
GEGKAFSSGGSFDLIDETIGDYEGRIRIMREARDLVLNLVNFDKPVVSAIRGPAVGAGLV
VALLADISVAGRTAKIIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCETLSGEEAE
RIGLVSTCVDDDDVLATATRLAENLAAGAQHAIRWTKHSLNHWYRMFAPAFETSLGLEFI
GFSGPDVQEGLAAHREKRPARFDSSPSS
NT seq 807 nt   +upstreamnt  +downstreamnt
atgcccgcaacttatgacgactttcccagcctgcgctgcgaacgcggcgacaacggaatc
ctcaacctggtgctcgacgctcccggactgaactcggtcggaccacagatgcaccgcgac
ctggccgacgtctggccggtgatcaaccgctatcccgacgtcaaggtggtcctggtccgc
ggcgaaggcaaggcgttctcctccggcggcagcttcgacctcatcgacgagacgatcggc
gactacgaaggtcgcatccgcatcatgcgggaggcccgcgacctggtgctcaacctggtc
aacttcgacaagccggtggtttcggcgatccggggtcctgccgtcggcgccggactggtg
gtggcgctgctggccgacatctcggtggcgggacggacggcgaagatcatcgacggacac
accaagctgggcgtggccgccggagatcacgccgcgatctgctggccgctgctggtgggg
atggccaaggccaagtactacctgctgacctgcgagacgctctccggcgaagaagccgag
cggatcggcctggtgtcgacctgcgtcgacgacgacgacgtgctggccaccgctacgagg
ctggcggagaatctggccgccggagcgcagcacgcgatccgctggaccaagcacagcctc
aaccactggtatcgcatgttcgccccggccttcgagacctcgctcggcctggaattcatc
ggcttcagcggtcctgacgtgcaggaagggctggccgcgcaccgcgagaagcgcccggcc
cggtttgacagcagtccgtcgagctga

KEGG   Mycobacterium paragordonae: C0J29_12920
Entry
C0J29_12920       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_12920
   00650 Butanoate metabolism
    C0J29_12920
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_12920
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_12920
   00310 Lysine degradation
    C0J29_12920
   00360 Phenylalanine metabolism
    C0J29_12920
   00380 Tryptophan metabolism
    C0J29_12920
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_12920
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_12920
   00281 Geraniol degradation
    C0J29_12920
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_12920
   00627 Aminobenzoate degradation
    C0J29_12920
   00930 Caprolactam degradation
    C0J29_12920
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_12920
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE95556
UniProt: A0A386U4V6
Position
2758649..2759458
AA seq 269 aa
MSLVLLEHPRPEIALITLNRPERMNSMAFDVMVPLKEALDQVTYDNSVRVVVLTGAGRGF
SSGADHKSAGAVPHVEDLTRPTYALRSMELLDEIILKLRRLHQPVIAAVNGAAIGGGLCL
ALAADIRVASTSAYFRAAGINNGLTASELGLSYLLPRAIGSSRAFEIMLTGRDVSAEEAE
RIGLVSCQVPGAQLLDTCYAIAARMAAFSRPGIELTKRTLWSGLDAGSLEGHMQAEGLGQ
LFVRLLTSNFEEAVAARAEKRPAVFTDDK
NT seq 810 nt   +upstreamnt  +downstreamnt
gtgagtttggtcctcctggaacacccgcggcccgagatcgccctcatcacgctcaatcgt
cccgagcggatgaactcgatggcgttcgacgtcatggtgccgttgaaagaggcgctcgat
caggtcacctacgacaactcggtgcgtgtggtggtgctcaccggcgccggccgcggattc
tcctcgggtgctgaccacaaatccgccggcgccgtcccgcatgtcgaagacctcacccgc
ccgacgtacgcgctgcggtccatggagttgctcgacgagatcattctgaagctgcgtcgg
ctgcaccagccggtgatcgccgcggtcaatggtgcggccatcggaggagggctgtgcctg
gcgctggccgccgacatccgggtggcctccaccagcgcgtatttccgggcagccggcatc
aacaacggtctcactgccagcgaactgggcctgagctacctgttgcccagggccatcggg
tcatcgcgggcattcgagatcatgttgaccgggcgtgacgtgtccgccgaggaggccgag
cggatcggactggtgtcatgccaggtgccaggagcgcagctgctggacacctgttatgcg
atcgccgcacggatggccgccttctcccgaccgggtatcgagttgaccaaacgcacgcta
tggagtggactggacgccggcagcctcgagggacacatgcaggccgaaggcctcggacag
cttttcgtccgtctgctcacctccaacttcgaagaagcggttgccgcacgcgcagagaag
cgcccggcggtcttcaccgacgacaaatag

KEGG   Mycobacterium paragordonae: C0J29_15100
Entry
C0J29_15100       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_15100
   00650 Butanoate metabolism
    C0J29_15100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_15100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_15100
   00310 Lysine degradation
    C0J29_15100
   00360 Phenylalanine metabolism
    C0J29_15100
   00380 Tryptophan metabolism
    C0J29_15100
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_15100
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_15100
   00281 Geraniol degradation
    C0J29_15100
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_15100
   00627 Aminobenzoate degradation
    C0J29_15100
   00930 Caprolactam degradation
    C0J29_15100
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_15100
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE95929
UniProt: A0A386U6H9
Position
3321489..3322460
AA seq 323 aa
MPEFDYEEMKKEAEPYIKFEKDVKNRIAYITFDRPDAQNSTTLGMRQNYADLIHKCNVDD
DVKVVVIRGEGEDFGSGGDLPEQRGMLENPGMPLLHELAINDDDVKYPPGGSYRYLSTVT
DFYAKARAGNRPLQELRKISIVEAKGYCYGWHFYQAGDADLVISSDDALFGHPAFRYVGW
GPRLWWWAETMGLRKFSEMLFTGRPFSAKEMYECGFINSVVPRDKLEEETAKYAMACARC
RPTDTVAVQKTFLELYKQHKGEYFGSLLTGMVEGMLPLIANDQDNDVDLTEGTFGKGLNN
VVKDNDLNFPPEWRLSRSGRQKP
NT seq 972 nt   +upstreamnt  +downstreamnt
atgcctgaattcgattacgaagaaatgaaaaaggaagccgagccgtacatcaagttcgag
aaggacgtgaagaaccggatcgcctacatcacgttcgaccgcccggacgcgcagaattcc
accaccctgggcatgcggcagaattatgccgacctgatccacaagtgcaatgtcgacgac
gacgtcaaggtcgtggtaatccgcggcgagggcgaggatttcggtagcggtggtgacctg
cccgaacagcgtggaatgctggagaacccgggcatgccgctactgcacgagctggcgatc
aacgacgacgacgtgaaatatccgccgggcggctcctaccgctacctgtccaccgtcacc
gacttctacgccaaagcccgcgccggaaaccgcccgctgcaagaacttcggaagatcagc
atcgtcgaggccaagggctactgctacggctggcacttctatcaagccggcgacgccgac
ctggtgatctcctcggacgacgccctgttcggacacccggcgttccgctacgtgggctgg
gggccacgcttgtggtggtgggccgagaccatgggcttgcgcaagttctccgaaatgttg
ttcaccgggcggcctttcagcgccaaggagatgtacgagtgcggcttcatcaacagcgtg
gtgccgcgcgacaagctcgaagaggaaacggccaagtatgcgatggcctgcgcacggtgc
cggccgaccgataccgtcgcggtgcagaagacgttcttggagctctacaagcaacacaag
ggcgaatatttcggcagtctgctcaccgggatggtcgaggggatgctgccgttgatcgcc
aacgaccaggacaacgacgtcgacctcaccgagggcactttcggcaagggtctgaacaac
gtcgtcaaggacaacgacctgaacttcccgccggagtggcgtctgagccgttcgggacgc
cagaaaccctga

KEGG   Mycobacterium paragordonae: C0J29_15215
Entry
C0J29_15215       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_15215
   00650 Butanoate metabolism
    C0J29_15215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_15215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_15215
   00310 Lysine degradation
    C0J29_15215
   00360 Phenylalanine metabolism
    C0J29_15215
   00380 Tryptophan metabolism
    C0J29_15215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_15215
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_15215
   00281 Geraniol degradation
    C0J29_15215
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_15215
   00627 Aminobenzoate degradation
    C0J29_15215
   00930 Caprolactam degradation
    C0J29_15215
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_15215
SSDB
Motif
Pfam: ECH_1 ECH_2 Carboxyl_trans
Other DBs
NCBI-ProteinID: AYE95950
UniProt: A0A386U5U5
Position
3351221..3352054
AA seq 277 aa
MERRVLEAVIYEREPPIARIILNRVDKANTKDAVLVTEVDTCLREADRDKEIKVVILKAN
GKGFCGGHVARWGPDENPYPDFGNTFEDLYKGTADLFLWPTLYLWEFPKPTISQIHGYCM
GGGIYLGLLTDFCVASEDAYFQMPLAQSLGEPGGHTMIEPWLLMNWHRTMDWLLLAPTLS
AQQALEWGLLNKVVPREDLEQTVEEMAHKIAQIPLTTLMAVKNNVKRAWELMGMRVHLQV
SHILTNMVGAASDVQARRAELMQSGMKPRDFVEGAES
NT seq 834 nt   +upstreamnt  +downstreamnt
atggagcggcgcgtcctggaagcggtcatctacgagcgcgagccaccgatcgcgcgcatc
atcctcaaccgggtcgacaaggccaacaccaaagacgctgtgctggttaccgaagtcgac
acgtgtctgcgagaagccgaccgcgacaaggagatcaaggtcgtcattctcaaagccaac
ggcaagggcttctgtggcggacatgtcgcccgctggggacccgacgagaatccctacccc
gacttcgggaacaccttcgaggatctctacaaaggcactgccgatctttttctgtggccg
acgttgtatctgtgggagtttccgaagccgacgatctcccagatccacggctactgcatg
ggcggcgggatctacctcgggctgctgaccgacttctgcgtcgcgtccgaggacgcgtat
ttccagatgccactggcccaaagcctcggcgaaccgggcggtcacaccatgatcgagccg
tggctgctgatgaactggcatcgcacgatggactggctgctgctggcaccgacgctgtcg
gcccagcaggcactcgagtggggcctgctcaacaaggtggtgccgcgcgaggacctcgag
cagaccgtcgaggagatggcgcacaagatcgcccaaattccgctgaccacgctgatggcg
gtgaagaacaacgtcaagcgggcctgggagttgatgggtatgcgcgtgcatcttcaggtc
agccacatcctgacgaacatggtgggcgcggcttccgacgtgcaggcccgtcgcgccgag
ctcatgcagtccgggatgaagccccgcgacttcgtcgagggcgccgagtcctga

KEGG   Mycobacterium paragordonae: C0J29_15235
Entry
C0J29_15235       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_15235
   00650 Butanoate metabolism
    C0J29_15235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_15235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_15235
   00310 Lysine degradation
    C0J29_15235
   00360 Phenylalanine metabolism
    C0J29_15235
   00380 Tryptophan metabolism
    C0J29_15235
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_15235
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_15235
   00281 Geraniol degradation
    C0J29_15235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_15235
   00627 Aminobenzoate degradation
    C0J29_15235
   00930 Caprolactam degradation
    C0J29_15235
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_15235
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE95954
UniProt: A0A386U5Y1
Position
complement(3356724..3357593)
AA seq 289 aa
MDLNETRERIIYEKEGPIARVTLNWPEKANAQDQKLAEEVDAALLDADRDYDIKVLVLKA
NGKGFCSGHAIGNNAVDYPAFVEGAKVMGTPWKPQTDLFVKPVMNLWEFSKPTIAQVHGY
CVGGGTHYGLTTDIVIAAEDAYFSYPPLQGFGMPSGECSIEPWVFMNWRRAAYYLYLAEV
IDAKKALEVGLVNEVVPRDQLDDRVEAIARHIAQAPMTTLLATKANLKRAWELMGMRVHW
QSSNDLVALASISKDVQELIQTVFRDKVLPSEQARRQAAAAASTDGAGT
NT seq 870 nt   +upstreamnt  +downstreamnt
atggatctcaacgagactcgcgaacggatcatctacgagaaagagggtccgatcgcccgc
gtcacgctgaactggccggagaaggccaacgcgcaggaccagaagctggccgaggaggtc
gacgccgcgctgctggacgccgaccgcgactacgacatcaaggtgctggtcctcaaggcc
aacggcaagggcttctgctcgggacacgccatcggcaacaacgccgtggactacccggcg
ttcgtcgagggcgcgaaggtgatgggcacaccgtggaagccgcagacggatctgttcgtc
aagccggtgatgaatctgtgggagttctccaaaccgaccatcgcgcaggtgcacggctac
tgcgtgggagggggcacgcactacgggctgaccaccgacatcgtcatcgcggccgaggac
gcgtacttctcctacccgccgctgcagggattcggcatgccgtccggtgaatgctcgatc
gagccctgggtgttcatgaactggcggcgggcggcctactacctctatctcgccgaggtc
atcgacgccaagaaggcgctggaggtcggactcgtcaacgaggtggtgccccgcgatcaa
ctggacgaccgcgtcgaggccatcgcccgccacatcgcgcaggcgccgatgacgacgctg
ctggcgaccaaggccaacctcaagcgggcctgggagctgatgggcatgcgggtgcactgg
cagagctcgaatgaccttgtcgcccttgcctcgatcagcaaggacgtgcaggagctgatc
cagaccgtgttccgggacaaggtgctgccctccgagcaggcacggcgccaggccgcggcg
gccgcctcgaccgacggcgccggcacctga

KEGG   Mycobacterium paragordonae: C0J29_16385
Entry
C0J29_16385       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_16385
   00650 Butanoate metabolism
    C0J29_16385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_16385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_16385
   00310 Lysine degradation
    C0J29_16385
   00360 Phenylalanine metabolism
    C0J29_16385
   00380 Tryptophan metabolism
    C0J29_16385
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_16385
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_16385
   00281 Geraniol degradation
    C0J29_16385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_16385
   00627 Aminobenzoate degradation
    C0J29_16385
   00930 Caprolactam degradation
    C0J29_16385
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_16385
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE96147
UniProt: A0A386U6N0
Position
complement(3611342..3612292)
AA seq 316 aa
MSVTGVGPVDHRSNGERPAGDFHFIRYETLDDGLIAVITLDRPKQRNAQTRGLLVELGSA
FERAETDDRVRVVVLRGAGPAFSAGHDLGSADDVRERSPGPGQHPTYQCNGGTFGGVESR
NRQEWHYYFENTKRWRNLRKITVAQVHGTVLSAGLMLAWCCDLIVASQDTVFADVVGTRL
GMCGVEYFGHPWEFGPRKAKELLLTGDSIGADEAHVLGMVSKVFPPDELADSTIAFARRI
AKVPTMAALLIKESVNQTVDAMGFTTALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYGLE
DWRDAPEIQPADKRRP
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagtgtcaccggggtcggtccggtcgatcaccggtcgaatggggagcgtcccgcggga
gacttccacttcatccggtacgagacgcttgacgatgggctgatcgcggtcatcaccctc
gaccgcccgaagcagcgcaacgcccagacccgcggactgctggtggagctgggcagcgcg
ttcgagcgcgcggaaaccgacgacagggttcgggtggtggtcctgcgcggcgccgggccc
gcgttctccgcaggtcacgacctcggctccgccgacgacgtccgcgagcgcagcccggga
cccggccagcaccccacctatcaatgcaacggcgggaccttcggtggggtggagtcgcgc
aatcgccaggagtggcactactacttcgagaacaccaagaggtggcgcaacctccgcaaa
atcaccgtcgcccaggtgcacggcaccgtgttgtcggcgggactgatgctggcgtggtgc
tgcgatctcatcgtcgcgagccaggacaccgtgttcgccgacgtggtgggcacgcggctg
ggcatgtgcggtgtcgagtacttcggccacccgtgggagttcggaccgcggaaggccaag
gaacttctgctcaccggggattcgatcggagccgacgaagcacacgtgctcggcatggtc
agcaaggtgttcccgcctgatgaactggcggacagcaccatcgcattcgcgcgccgaatc
gcgaaagtgccgaccatggcggcgttactgatcaaggagtcggtcaatcagaccgtcgac
gccatgggattcaccaccgccctggacggctgtttcaagatccaccaactcaaccacgcg
cactggggtgaggtcaccggcggaaagctgtcctacggaaccgtcgagtacggactcgaa
gactggcgcgacgcgcccgagatccagcccgccgacaagcgacgaccctga

KEGG   Mycobacterium paragordonae: C0J29_22145
Entry
C0J29_22145       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_22145
   00650 Butanoate metabolism
    C0J29_22145
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_22145
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_22145
   00310 Lysine degradation
    C0J29_22145
   00360 Phenylalanine metabolism
    C0J29_22145
   00380 Tryptophan metabolism
    C0J29_22145
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_22145
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_22145
   00281 Geraniol degradation
    C0J29_22145
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_22145
   00627 Aminobenzoate degradation
    C0J29_22145
   00930 Caprolactam degradation
    C0J29_22145
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_22145
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE97092
UniProt: A0A386U9C2
Position
complement(4942659..4943549)
AA seq 296 aa
MTAADTADDRVLFDVDHDQRIATITLNNPGRHNTYDPAMRDAMARCLDQVAEDDDLTVVL
LRGADGTFSTGADMNNAYGWYGEAAGGDAAAPKKPSQRRRLTVDRKSFGFYHNLMGFPKV
TVGEIAGYALGGGFEMALMTDISVIAGDTKIGMPATRFLGPALGSLHMFFHRLGPVLARR
LLLTGDVIEAGDLAHLGIFTETCDSASVTARARYWAEKAAKMPADGVVIAKEAFRLVEQS
QVYQGEEVASYLFHAFGTNLQFAPGEFNFVKTRAQHGTKEAFRLRDEHFHVPEPEA
NT seq 891 nt   +upstreamnt  +downstreamnt
atgacggccgcggacactgctgacgaccgggtcctgttcgacgtcgaccacgaccagcgc
atcgccacgatcaccctgaacaaccccgggcggcacaacacatatgacccggccatgcgc
gacgccatggcacgctgtctggatcaggtcgccgaagacgacgacctcaccgtggtgttg
ttgcgcggcgcggatggcaccttcagcaccggggcggatatgaacaacgcctacggctgg
tacggcgaggccgccggcggggacgcggcggcaccgaagaagcccagccagcgtcgtcga
ctcaccgtggaccgcaagtcatttggcttctatcacaacctcatgggcttccccaaggtc
accgtgggagagatcgccggctacgccctcggcgggggattcgagatggcgctgatgacc
gacatctcggtgatcgccggcgacaccaagatcggcatgccggccacccgtttcctcggg
cccgcgctgggcagtctgcacatgttcttccaccggttgggaccggtactcgcccggcgc
ctgctgctgaccggtgatgtgatcgaggccggtgacctcgcgcatctcggaatcttcacg
gagacatgcgattccgcgtcggtgacggcccgtgcccggtactgggcggagaaggcggcc
aagatgccggccgacggcgtcgtcatcgccaaggaagcgttccggctggtggaacagagc
caggtttaccagggcgaggaagtcgcgagttacctgttccacgcgttcggcaccaacctg
cagttcgcaccgggcgagttcaacttcgtcaagacgcgggcgcagcacggcaccaaggag
gcgttccggttgcgcgacgaacactttcacgttccggaacccgaagcgtga

KEGG   Mycobacterium paragordonae: C0J29_23595
Entry
C0J29_23595       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_23595
   00650 Butanoate metabolism
    C0J29_23595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_23595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_23595
   00310 Lysine degradation
    C0J29_23595
   00360 Phenylalanine metabolism
    C0J29_23595
   00380 Tryptophan metabolism
    C0J29_23595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_23595
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_23595
   00281 Geraniol degradation
    C0J29_23595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_23595
   00627 Aminobenzoate degradation
    C0J29_23595
   00930 Caprolactam degradation
    C0J29_23595
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_23595
SSDB
Motif
Pfam: ECH_1 ECH_2 MCPsignal
Other DBs
NCBI-ProteinID: AYE97317
UniProt: A0A386UA27
Position
5281833..5282645
AA seq 270 aa
MSKSGIAALAPVAGLDVDLTDGVLSLTINRPDSLNSLIIPVITGLADAMEAAATDPAVRV
VRLGGAGRGFSSGAGISADDMSSGGGVPPDEIILEINRLVRAITTLPHPVVAVVQGPAAG
VGVSIALSCDVVLASEKAFFMLAFTKIGLMPDGGASALVAAAVGRIRAMRMALLPERLTA
TEALSWGLVSAVYPADDFDAEVDKVVTRLLTGPAVAYAKTKTAINAATLTELNPTLQREF
EGQRGLLQAPDFKEGTRAFQERRSPNFTDS
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtccaaatccggaattgccgctctcgcccccgtcgccggccttgacgtcgacctgacc
gacggcgtgctgtcgctgacgatcaaccgacccgacagcctcaactcgctgatcattccg
gtcatcaccggtctggccgacgcgatggaggccgccgccaccgaccccgcggtgcgggtg
gtgcgactcggcggcgccggtcgcggcttcagttccggagccggcatcagcgccgacgac
atgtccagcggcggcggcgttcccccggacgagatcatcctggaaatcaaccgtctggtc
cgggcgatcaccacgttgccgcacccggtggttgccgtcgtgcagggaccggcggccggc
gtcggcgtatctatcgccctgtcttgcgacgtcgtattggcttcggagaaggcatttttc
atgctcgccttcacgaagatcggcttgatgcccgacggcggcgcgtcggctctggtcgct
gccgcggtgggccggatcagggccatgcggatggcgctgctgcccgagcggctcacagcg
accgaggcgctgtcgtggggtctggtgagcgcggtctatccggccgacgacttcgacgcc
gaagtggacaaagtggtcacgcgcttgctgaccggcccggccgtggcgtacgccaagacc
aagaccgcgatcaacgcggccaccctcaccgagctgaaccccaccctccagcgggagttc
gaaggtcaacgcggcctgctgcaggcgcccgacttcaaagaagggacccgggcattccag
gaacgccgctcgcccaacttcaccgactcttga

KEGG   Mycobacterium paragordonae: C0J29_24220
Entry
C0J29_24220       CDS       T06847                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_24220
   00650 Butanoate metabolism
    C0J29_24220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_24220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_24220
   00310 Lysine degradation
    C0J29_24220
   00360 Phenylalanine metabolism
    C0J29_24220
   00380 Tryptophan metabolism
    C0J29_24220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_24220
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_24220
   00281 Geraniol degradation
    C0J29_24220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_24220
   00627 Aminobenzoate degradation
    C0J29_24220
   00930 Caprolactam degradation
    C0J29_24220
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_24220
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-ProteinID: AYE97424
UniProt: A0A386UA13
Position
5442938..5443999
AA seq 353 aa
MTGVDEGAVTGESDEILTRVVDGVGYITLNRPKAINSLNQTMVDLLSTVLIRWARDDAVR
AVVLTGAGERGLCAGGDVVALYHSARKDGVDARRFWRDEYLMNGLIGRFAKPYVAVMDGI
VMGGGVGVSAHANTRVVTDASKVAMPEVGIGFIPDVGGMYLLSRAPGKLGLHAALTGAPF
NGADAIALGFADHYVPHTELDAFTTAVATNGVEGALARHATEPPPSELAAQREWIDECYS
ADSVIDIVAALRGHRAGPANEAADLISTRSPIALSVTFEAARRAADLETLEDVLVQDYRV
SSASSRSHDFVEGIRAQLVDKDRNPKWSPASLAEVTVADVAAYFAPVDDDLQF
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgacaggggttgacgagggggccgtaacaggggaatccgacgaaatcctgacccgcgtc
gtcgacggcgtcggctacatcaccctgaaccggcccaaggccatcaattcgctaaaccag
acgatggtcgacctcctgagcaccgtgctgatccgatgggcacgcgacgacgcggtgcgg
gcggtggtgctcaccggcgccggggagcgcggactgtgcgcgggcggtgacgtggtcgcg
ctctaccacagcgcgcgcaaggacggggtcgacgcacgccggttctggcgcgacgagtac
ctgatgaacggtctgatcggccgcttcgccaaaccgtacgtggcggtgatggacggcatc
gtgatgggcggtggcgtcggcgtcagcgcgcacgcgaacaccagggtggtcaccgacgcc
tcgaaggttgcgatgccggaggtgggcatcggcttcatccccgacgtcggtgggatgtac
ctgctctcgcgcgccccaggcaagttgggccttcatgcggccctcaccggggcaccgttc
aacggcgctgacgccatcgcgctgggtttcgccgaccattacgtgccgcacaccgaactc
gacgctttcaccacggcggtagcgacgaacggcgtcgaaggtgcgctcgcccgacacgca
accgagccgccacccagtgagcttgcggcacaacgggagtggatcgacgagtgctattcg
gccgacagtgtgatcgatatcgtggccgcattgagaggccatcgcgccgggccggccaac
gaggccgccgacctcatcagcactcgctcccccatcgccttgtccgtgacattcgaggcg
gcgcgtcgcgccgctgacctcgaaacactggaagatgttctggtgcaggactatcgggtg
tcctccgcgtcgtctcgctcgcacgacttcgtggaaggcattcgcgcgcaactggtcgat
aaggaccgcaacccgaagtggtcgccagcatcgctggccgaggtcaccgtggccgacgtc
gccgcatatttcgcgcccgtcgacgacgacttacagttctag

KEGG   Mycobacterium paragordonae: C0J29_24225
Entry
C0J29_24225       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_24225
   00650 Butanoate metabolism
    C0J29_24225
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_24225
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_24225
   00310 Lysine degradation
    C0J29_24225
   00360 Phenylalanine metabolism
    C0J29_24225
   00380 Tryptophan metabolism
    C0J29_24225
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_24225
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_24225
   00281 Geraniol degradation
    C0J29_24225
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_24225
   00627 Aminobenzoate degradation
    C0J29_24225
   00930 Caprolactam degradation
    C0J29_24225
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_24225
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF218
Other DBs
NCBI-ProteinID: AYE97425
UniProt: A0A386UAF1
Position
5444012..5444785
AA seq 257 aa
MAYETILVEREERVGIITLNRPKALNALNSQVMHEVTSAATELDSDPAIGAIIITGSEKA
FAAGADIKEMAGLTFADAFGADFFAPWGKLAAVRTPTIAAVAGYALGGGCELAMMCDLLI
AADTAKFGQPEIKLGVIPGMGGSQRLTRAIGKAKAMDLILTGRTIDAAEADRSGLVSRLV
PADDLLTEAKAVATTISQMSLPSAQMAKEAVNRAFESTLAEGLLYERRLFHSTFATDDQS
EGMTAFIEKRPPDFTHR
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcttacgaaaccatcctcgtcgagcgcgaagagcgggtcggcatcatcacactgaac
cggccgaaggcgctcaacgccctcaacagccaggtgatgcacgaagtcaccagcgcagca
acggaattggacagcgacccagccatcggtgcgatcattatcaccggctctgagaaggcg
ttcgccgccggggccgatattaaggagatggccgggttgacgttcgccgacgccttcggc
gccgacttcttcgctccctggggcaaactggccgccgtgcggaccccgacgatcgcggcg
gtcgccgggtatgccctcggcggtgggtgcgagctggcgatgatgtgcgacctcctgatc
gccgcggacacagcgaaattcggccagcccgagatcaagctcggtgtcattcccggcatg
ggcggctcgcaacggctgacccgggccatcggcaaagccaaggcgatggacctcatcctg
accggccgcaccatcgacgccgcggaagccgaccgcagcggcctggtttcgcgactggtg
cccgccgacgacctgctcaccgaagccaaggccgtcgcgacgacaatctcgcagatgtcg
ctgccgtccgctcagatggccaaggaggccgtcaaccgggccttcgaatcgactctggct
gaaggacttctctacgagcggcggcttttccactcgactttcgccaccgatgaccagtcc
gaaggcatgacggccttcattgaaaagcgcccgcccgacttcacccaccgatga

KEGG   Mycobacterium paragordonae: C0J29_25005
Entry
C0J29_25005       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_25005
   00650 Butanoate metabolism
    C0J29_25005
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_25005
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_25005
   00310 Lysine degradation
    C0J29_25005
   00360 Phenylalanine metabolism
    C0J29_25005
   00380 Tryptophan metabolism
    C0J29_25005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_25005
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_25005
   00281 Geraniol degradation
    C0J29_25005
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_25005
   00627 Aminobenzoate degradation
    C0J29_25005
   00930 Caprolactam degradation
    C0J29_25005
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_25005
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE97558
UniProt: A0A386UBA9
Position
5607586..5608371
AA seq 261 aa
MDTLVEYAREGVVARLTLNSPHNRNALSTTLVTQLHEGLRAAAADPAVRVVVLGHSGGTF
CAGADLSEAGGGDPFELAVARAKEMTALLRAIVSSPRPVIGAIDGHVRAGGFGLVGACDM
VVAGPRSTFALTEARIGVAPAIISLTLLPKLSARAAARYYLTGETFGASEAAEIGLITLA
ADDVDAAVAGLVADVGRGSPQGLAASKALTTAAVLDGFDRNAERLTEESARLFVSDEARE
GMLAFLQKRPPSWVSDAGQTS
NT seq 786 nt   +upstreamnt  +downstreamnt
atggacactctcgtcgagtacgcccgggagggcgtggttgcccggctcacgctgaactcg
ccgcacaaccgcaacgccttgtcgaccacgttggtcacccagctgcatgaagggttgcgc
gccgccgcggcggacccggcggtacgggtggtggtgctcggccacagcggcggcaccttc
tgtgcaggcgccgacctgtccgaggccggcggtggcgacccgttcgagctggccgtggcg
cgggccaaggagatgaccgcgctgttgcgcgccatcgtctcctcgccgcggccggtgatc
ggcgccatcgacggccatgtgcgggccggcggattcggtctggttggcgcgtgcgacatg
gtggtggccgggccgcgcagcacgtttgccctgaccgaagcgcgcatcggcgtggcgccg
gcgatcatctcgctgaccctgctgccgaagctgtcggcccgggccgccgcacggtattac
ctcaccggggaaaccttcggcgccagcgaagccgccgagatcggtttgatcaccctggcc
gccgacgacgtcgacgccgcggtggccggcctggtggccgacgtcggacgcggctcgccg
cagggtttggcggcatccaaagcgctcaccaccgccgccgtactggacggcttcgatcgc
aatgccgagcggctcaccgaggaatcggcgcggctgttcgtgtcagatgaggcgcgcgaa
ggcatgctcgcgttcctgcagaaacggccgccgagctgggtctccgacgcaggtcagacg
tcctga

KEGG   Mycobacterium paragordonae: C0J29_25410
Entry
C0J29_25410       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_25410
   00650 Butanoate metabolism
    C0J29_25410
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_25410
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_25410
   00310 Lysine degradation
    C0J29_25410
   00360 Phenylalanine metabolism
    C0J29_25410
   00380 Tryptophan metabolism
    C0J29_25410
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_25410
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_25410
   00281 Geraniol degradation
    C0J29_25410
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_25410
   00627 Aminobenzoate degradation
    C0J29_25410
   00930 Caprolactam degradation
    C0J29_25410
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_25410
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE97629
UniProt: A0A386UBM7
Position
complement(5709198..5709929)
AA seq 243 aa
MIGITQTEAVTTIELQRPERRNALNSQLVEELREALLKADGAETRVVVLTGQGTAFCAGA
DLSGDAFAADYPDRLVELHRVMDAVPVPVIGAINGPAIGAGLQLAMQCDLRVVAPDAFFQ
FPTSKYGLALDNWSIRRLSSLVGHGRARAMLLTAEKLTADVALQTGMANRIGTLADAQEW
AAEISGLAPLAIQHAKRVLNDDGSIEEPMPEHKDLFDKAWGSQDVIEAQVARIEKRPPNF
QGA
NT seq 732 nt   +upstreamnt  +downstreamnt
atgatcggtatcacccagaccgaagccgtcacgaccatcgagttacagcggcccgagcga
cgcaatgccctgaactcccagctcgtcgaggagctgcgggaagctctcctgaaggccgac
ggggcagagacccgggtcgttgtgctgaccggccagggcacggcgttctgcgccggcgct
gacctgtccggagacgccttcgccgccgattaccccgaccgcctggtcgagctgcaccgc
gtgatggacgcggtgccggtccccgtcatcggcgccatcaacggaccggccatcggcgcg
ggcctgcagctggccatgcagtgcgacctgcgggtcgtcgccccggacgccttctttcag
ttccccacttcgaaatacggcctggccctggacaactggagcatccgccggctctcgtcg
ctggtcggtcacggacgggcccgggccatgctgctgaccgccgagaagctgacagccgat
gtggcgctgcagaccggcatggccaaccggatcggcaccctggccgatgcgcaggaatgg
gccgcggagatctccggtctggcgccgctggctatccagcacgcgaagcgggtactcaac
gacgacggctcgatcgaagaacccatgcccgagcacaaagacctgttcgataaggcctgg
ggcagccaagatgtgatcgaggcgcaggtcgctcggatcgagaagcggccgccgaacttt
cagggggcgtaa

KEGG   Mycobacterium paragordonae: C0J29_25705
Entry
C0J29_25705       CDS       T06847                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01200  Carbon metabolism
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_25705
   00650 Butanoate metabolism
    C0J29_25705
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_25705
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_25705
   00310 Lysine degradation
    C0J29_25705
   00380 Tryptophan metabolism
    C0J29_25705
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_25705
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_25705
   00281 Geraniol degradation
    C0J29_25705
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_25705
   00930 Caprolactam degradation
    C0J29_25705
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     C0J29_25705
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_25705
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     C0J29_25705
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C DAO DUF3368 NAD_binding_8
Other DBs
NCBI-ProteinID: AYE97681
UniProt: A0A386UC09
Position
complement(5781023..5783167)
AA seq 714 aa
MADNTIQWDKDADGIVTLTLDDPSGSANVMNEAYIESMGKAVDRLVAEKDSITGVVITSA
KKTFFAGGDVKSMIQIGPENAGEAFDLVENVKKQLRTLETLGKPVVAALNGAALGGGLEI
ALACHHRIAADVKGAQFGFPEATLGLLPGAGGVTRSVRMFGIQNAFVNILSQGTRFKPAK
AKELGLIDELLPTVEELVPAAKAWIKANPDSHEQPWDKKGYKMPGGTPSSPGLASILPSF
PALLRKQIKGAPMPAPKAILSAAVEGAQVDFDTASRIESRYFTTLVTGQVSKNMIQAFFF
DLQAINAGKSRPDGIEPVKINKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSIEAAQKGK
GYSEKLEAKALERGRTTQEKSDALLARITPTADPADFKGVDFVIEAVFESQDLKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGSQAGYP
APPLQLSDELNLELMHKIAVATRKGVEDAGGKYEPHPAEAVVEKMIEVGRSGRLKGAGFY
EYPDGKRSGLWPGLRETFKSGSVELPLQDMIDRMLFAEALETQKCLDENVLMTTADANIG
SIMGIGFPPWTGGSAQYIVGYEGPLGRGKEAFVARARELAEKYGDRFLPPDSLT
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggccgacaacacaattcagtgggacaaggatgccgacggcatcgtcacgctgaccctg
gacgacccgtcggggtcggccaacgtgatgaacgaggcttacatcgagtcgatgggcaag
gcggtcgatcgccttgtcgcggagaaggattcgatcaccggcgtggtgatcaccagcgcc
aagaagaccttcttcgccggcggtgacgtcaagagcatgatccagatcggtccggagaac
gccggtgaagcatttgatctggtcgagaacgtcaagaagcagttgcgcacgctcgagacc
ctgggcaagccggtcgtggcggccctcaacggcgccgcgctcggcggcggcctagagatc
gcgctggcctgccaccaccggatcgcggccgacgtcaagggagctcagttcggcttcccc
gaggcgacgctgggtctgttgccgggtgccggcggtgtgacccgcagcgtccggatgttc
ggcatccagaatgccttcgtcaacatcctgtcgcagggcacccggttcaagccggccaag
gccaaggagctcggtctgatcgacgagctgctgccgacggtcgaggagttggtgcctgcc
gccaaggcgtggatcaaggccaaccccgacagccacgagcagccgtgggacaagaagggc
tacaagatgcccggcggcacaccgtcgtcgccagggctggcgtcgatcctgccgtcgttc
cccgccttgctgcgtaagcagatcaagggtgcgccgatgccggcgccgaaggcgatcctg
tcggccgcggtcgagggcgcgcaggtggacttcgacacggccagccgcatcgagagccgt
tacttcaccacgctggtcaccggccaggtgtcgaagaacatgatccaggcgttcttcttc
gacctgcaggccatcaacgccggcaagtcacgcccggacggcatcgagccggtcaagatc
aacaagatcggtgtgctcggcgccggcatgatgggcgcgggcatcgcctacgtctcggcc
aaagccggctacgacgtggtcctcaaagatgtgagcatcgaggccgcgcagaagggtaag
ggttactccgagaagctggaggccaaggcgctggagcggggccgcaccacgcaggagaag
agcgacgctctgctggcgcgcatcactccgaccgccgaccccgccgacttcaagggcgtc
gacttcgtgatcgaggccgttttcgagagccaggacctcaagcacaaggtcttccaggag
atcgaggacatcgtcgagcccaacgcactgctcggctccaacacctcgacgctgcccatc
accggtctggcgactggcgtcaagcggcaggaggacttcatcgggatccacttcttctcg
ccggtcgacaagatgcccctggtggagatcatcaagggcgagaagacttctgacgaggcg
ctggcccgggtgttcgactacacgctggccatcggcaagaccccgatcgtggtcaacgac
agccgcggtttcttcacctcacgcgtgatcggcaccttcgtcaacgaggcgctggcgatg
ctgggcgagggtgtcgagccggccagcatcgagcaggcgggttcgcaggccggttacccg
gcgccgccgttgcagctctccgacgagctcaacctggagctgatgcacaagatcgcggtc
gctacccgcaagggtgtcgaggacgccggcggcaagtatgagccgcacccggcagaagcc
gtggtggagaagatgattgaggtcggacggtcgggccgtctcaagggcgccggcttctac
gagtaccccgacggcaagcgttccggtttgtggccgggcctgcgggagacgttcaagtca
ggttcggttgagctgccgctgcaggacatgatcgaccggatgctgttcgccgaggcgctg
gaaactcagaagtgcctcgacgagaacgtgctgatgaccactgccgacgcgaacatcgga
tcgatcatgggcatcgggtttccgccgtggaccggtggtagcgcgcagtacatcgtcggt
tacgagggtccgctcggccggggcaaggaagccttcgtggcccgcgcccgcgagctggcc
gagaagtacggcgaccggttcctgccgccggactcactcacgtaa

KEGG   Mycobacterium paragordonae: C0J29_26020
Entry
C0J29_26020       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_26020
   00650 Butanoate metabolism
    C0J29_26020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_26020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_26020
   00310 Lysine degradation
    C0J29_26020
   00360 Phenylalanine metabolism
    C0J29_26020
   00380 Tryptophan metabolism
    C0J29_26020
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_26020
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_26020
   00281 Geraniol degradation
    C0J29_26020
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_26020
   00627 Aminobenzoate degradation
    C0J29_26020
   00930 Caprolactam degradation
    C0J29_26020
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_26020
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF5030
Other DBs
NCBI-ProteinID: AYE97733
UniProt: A0A386UAT3
Position
complement(5840667..5841434)
AA seq 255 aa
MSVVQQAPSSGVAVIRLNRPERLNAINHAMLADLTKAFADLPADTRAVVLTGEGRGFCSG
LDVRDFGSGIPEADDPAIDRLRFQQAMAALPQAIRDLPQPVIAAVNGPCVGAGLALCLAA
DIRICSTTAKFGNAAILLGLSGAEMGMSYHLPRIVGTSVAADWMLTGRTVSAEEADRRGL
VSQLVAPEELEDRALELAGQIAGLTTLGVQLTKRALQVNTDAPGLGPAIELENRNQVLSH
ATDEAAALRRRWSER
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgagtgtggttcagcaggcaccgagttccggtgtggcggtgatccggctgaaccgcccg
gagcggttgaacgcgatcaaccacgcgatgctggcggacctcaccaaggcgtttgcggat
ctccccgccgacacgcgggcggtggtgctcaccggcgagggccgcggcttctgctccggg
ctcgatgtgcgcgacttcggcagcgggatcccggaggccgacgatccggccatcgaccgg
ctgcgatttcagcaggcgatggccgcgctgccgcaggcgatccgggacctgccgcagccg
gtgatcgcggcggtcaacgggccgtgcgtcggcgcggggctggcgttgtgcctcgcggcc
gacatccggatctgttcgacgacagcgaaattcggaaacgcggccatcttgttggggctc
tcgggtgccgagatggggatgagctaccacctgccgcgcattgtcggcaccagtgtcgcc
gcggactggatgctcaccggccggaccgtgtccgccgaggaggccgaccgccgtgggttg
gtgagccagctggtagcgccggaggagttggaagaccgcgcgctcgagttggcgggacaa
atcgccggtctcaccacgctcggcgtccagctgacaaagcgtgcgctgcaagtgaatacg
gatgccccgggcctgggcccggcgatcgaactggagaaccgcaaccaggtgctcagtcat
gccaccgacgaggccgccgcgcttcgccgccggtggtctgagcgctga

KEGG   Mycobacterium paragordonae: C0J29_26150
Entry
C0J29_26150       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_26150
   00650 Butanoate metabolism
    C0J29_26150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_26150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_26150
   00310 Lysine degradation
    C0J29_26150
   00360 Phenylalanine metabolism
    C0J29_26150
   00380 Tryptophan metabolism
    C0J29_26150
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_26150
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_26150
   00281 Geraniol degradation
    C0J29_26150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_26150
   00627 Aminobenzoate degradation
    C0J29_26150
   00930 Caprolactam degradation
    C0J29_26150
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_26150
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE97758
UniProt: A0A386UBU8
Position
complement(5866872..5867837)
AA seq 321 aa
MAADSKAKKIIRYDKDAKTRIATITFDRPEYLNAPTIAARHRYADLLHRAGVDDDVKVVV
IRGAGDDLGSGADLKEFMRAKDSDDPGPLLTEFRLGAGDVTYPPRGSFRHGASVGQWYAN
PNSGIRGLQDFKKISILEVKGYCYGWHFYQAADADLVIASDDALFGHPSFRYYGWGPRMW
WWAQTMGIRKFQEMVFTGRAFTAAEMYDCNFLNSVVPRAGLEAEVEKYALACARNRPTDT
VFMQKTFFEIMKQFQGEYMGSLLSGFFESAGGSVRADGDDFLLDDAVGRGLGGAVKANDD
NFPPDWRLSKGARGKGRKAKR
NT seq 966 nt   +upstreamnt  +downstreamnt
atggccgctgactccaaggccaagaagatcattcgctacgacaaggacgccaagacccgc
atcgcgaccatcaccttcgaccggcccgagtacctgaacgcgccgacgatcgcggcgcgg
caccgctacgccgacctgctgcaccgggccggcgtcgacgatgacgtcaaggtcgtcgtg
atccgcggcgccggtgacgatctgggatccggcgcggacctaaaagagttcatgcgggcc
aaagactccgacgatcccggacccctgctgaccgaattccggttgggcgccggtgacgtc
acctatccgccccgcggttcgttccggcacggcgcctcggtggggcagtggtacgccaac
ccgaactccggaatccgcggactgcaggacttcaagaagatctccattctcgaagtcaag
ggctactgctacggctggcacttctaccaggcagccgacgcagacctggtaattgcctct
gacgacgcacttttcgggcatccgtcgttccggtactacggctggggaccccggatgtgg
tggtgggcccagactatgggcatccgcaaatttcaggagatggtgttcaccgggcgggcg
ttcaccgccgccgagatgtatgactgtaacttcctcaacagcgtggtgccacgcgccggg
ctggaggccgaggtcgagaagtacgcgctggcctgcgcgcgtaaccggcctaccgacacg
gttttcatgcagaagacgttcttcgagatcatgaagcagtttcagggcgagtacatgggc
agtctgctgagcggcttcttcgagtccgccgggggcagcgtgcgcgcggatggcgacgac
ttcctcctcgacgacgcggtcggccggggtctcggtggcgccgtcaaggccaacgacgac
aacttcccgccggactggcggttgagcaagggggcgcgcggcaagggccgaaaggccaag
cggtag

KEGG   Mycobacterium paragordonae: C0J29_26345
Entry
C0J29_26345       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_26345
   00650 Butanoate metabolism
    C0J29_26345
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_26345
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_26345
   00310 Lysine degradation
    C0J29_26345
   00360 Phenylalanine metabolism
    C0J29_26345
   00380 Tryptophan metabolism
    C0J29_26345
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_26345
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_26345
   00281 Geraniol degradation
    C0J29_26345
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_26345
   00627 Aminobenzoate degradation
    C0J29_26345
   00930 Caprolactam degradation
    C0J29_26345
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_26345
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE97791
UniProt: A0A386UCC9
Position
complement(5910331..5911098)
AA seq 255 aa
MYDMPSEIDVRAEGALRIITLNRPDDLNAVNDSLHVGLARLWQRLTDDASARAAVITGSG
KAFSAGGDFAYLAELAEDAALRAKTIRDGREIVLGMARCRIPVIAAVNGPAVGLGCSLVA
LSDIVFIAPDAFLADPHVQVGLVAADGGPLTWPLHISLLLAKEYALTGTRIRAQRAVELG
LANHVADDPFAAAVECAKKIMELPQQAVESTKRVLNIHLERAVLASLDYALSAEHQSFVT
EDFRAIVSKLNAGKN
NT seq 768 nt   +upstreamnt  +downstreamnt
atgtacgacatgccaagcgaaatcgacgtccgggccgagggggcgttgcggatcatcacg
ctgaaccgcccggacgatctcaacgccgtcaacgacagtctgcacgtcgggctggcgcgg
ttgtggcagcggttgaccgacgacgcgtcggcgcgcgccgccgtgatcaccggcagcggc
aaagccttctcggcgggtggggatttcgcgtacctggccgaactggccgaagatgccgca
ttgcgcgccaagacgattcgcgacggacgcgagatcgtactggggatggcgcggtgccgg
atcccggtgatagcggccgtcaacggcccggccgtcggattgggctgcagtttggtggcg
ctgagcgacatcgtcttcatcgccccggacgccttcctggccgacccgcacgtgcaggtg
gggttggtggccgccgacggcggaccgctgacctggccgctgcacatcagcttgttgctg
gcgaaggaatatgcgttgaccggcaccaggattcgcgctcagcgggcggtcgagctcggc
ctggccaaccacgtggccgacgacccgttcgccgcggcggtggagtgtgccaaaaagatc
atggagctgccgcagcaggcggtggagagcaccaaacgggtgctcaacatccacctggaa
cgcgccgtgctggccagcctcgattacgcgttgtcggccgaacatcaatcgttcgtgaca
gaggatttccgggcgatcgtcagcaagctcaacgccggcaagaattga

KEGG   Mycobacterium paragordonae: C0J29_27235
Entry
C0J29_27235       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_27235
   00650 Butanoate metabolism
    C0J29_27235
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_27235
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_27235
   00310 Lysine degradation
    C0J29_27235
   00360 Phenylalanine metabolism
    C0J29_27235
   00380 Tryptophan metabolism
    C0J29_27235
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_27235
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_27235
   00281 Geraniol degradation
    C0J29_27235
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_27235
   00627 Aminobenzoate degradation
    C0J29_27235
   00930 Caprolactam degradation
    C0J29_27235
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_27235
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE99181
UniProt: A0A386UGN3
Position
complement(6094706..6095647)
AA seq 313 aa
MTLSDQTSAGAESQNADTPQMVVYETLDEGRIARIWLNRPDAHNAQNRTLLVQLDEAFAR
AEADDTVRVVILAARGRNFSAGHDLGSEEAMLERKPGPHQHPTFRSHGATLEPIVEKLYH
QEWHFFFENTRRWRDLRKITIAQVQGNAISAGLMLIWACDLIVAADNAKFSDVVAVRLGM
PGVEYYAHPWEFGARKAKELLLTGDSLDADEAYRLGMVSKVFPLDDLEEKTLEFARRIAE
RPTMASLLVKASVNAAADAMGFTEALRHAFHVHELGHAHWAAHNENRFPVGLPPDVEDWR
TARPTKVARRDIP
NT seq 942 nt   +upstreamnt  +downstreamnt
atgacactttccgatcagaccagcgctggcgctgagtcccagaacgccgataccccgcag
atggtggtctacgaaacgctggatgagggccgtatcgcgcggatctggctgaaccggccg
gacgcccacaacgcgcagaaccgcaccctgctggtgcagctggacgaggcgttcgcgcgt
gccgaggccgacgacaccgtgcgtgtggtgatcctggcggcgcgcggccgcaacttctcc
gccggccacgacctcgggtcggaggaggcgatgctggagcgcaagcccgggccgcaccag
catccgacgttccgctcgcacggcgccaccctcgagccgatcgttgagaagctctaccac
caggagtggcacttcttcttcgagaacacccgtcgctggcgcgacctgcgcaagatcacc
atcgcccaggtgcagggcaacgccatctcggccgggttgatgctgatctgggcctgcgac
ctgatcgtggccgccgacaacgccaagttcagcgacgtggtcgcggtgcggctgggcatg
ccgggcgtcgaatattatgcgcacccttgggaattcggcgcgcgcaaggccaaagagcta
ctgctgaccggtgattcgctggatgccgacgaggcctaccggctcggcatggtgtccaag
gtcttcccgctcgacgacctcgaggagaagaccctcgagttcgcgcggcgcatcgccgaa
cgacccaccatggcgtcgctattggtgaaggcctcggtcaacgcggccgccgacgccatg
ggcttcaccgaggcgctgcgccacgcgttccacgtccacgaactcgggcacgcgcactgg
gcggcgcacaacgagaacagattcccggtcgggttgccgcccgacgtcgaggactggcgc
accgcccggccgaccaaggtcgcccgccgcgatatcccatag

KEGG   Mycobacterium paragordonae: C0J29_27445
Entry
C0J29_27445       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_27445
   00650 Butanoate metabolism
    C0J29_27445
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_27445
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_27445
   00310 Lysine degradation
    C0J29_27445
   00360 Phenylalanine metabolism
    C0J29_27445
   00380 Tryptophan metabolism
    C0J29_27445
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_27445
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_27445
   00281 Geraniol degradation
    C0J29_27445
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_27445
   00627 Aminobenzoate degradation
    C0J29_27445
   00930 Caprolactam degradation
    C0J29_27445
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_27445
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE97962
UniProt: A0A386UBL9
Position
6160381..6161190
AA seq 269 aa
MAEQPANESGPDALVEQRGHTLIVTMNRPHRRNALSTEMMQIMVEAWDRVDNDPDIRCCI
LTGAGGYFCAGMDLKTATQKPPGDSFKDGSYDPSRIDALLKGRRLTKPLIAAVEGPAIAG
GTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYAVACDLLLTGRHITAT
EALEMGLIGHVVPDGQALTKALELAEIIENNGPLAVQAILRTIRETEGMHENEAFKIDTQ
IGIQVFLSDDAKEGPRAFAEKRKPEFKNR
NT seq 810 nt   +upstreamnt  +downstreamnt
gtggcggagcagccagcaaacgaatctggacctgacgcactggtggagcagcgtggtcac
acgctcatcgtgaccatgaaccggccgcaccgccgcaacgcgctgagcactgaaatgatg
cagatcatggtcgaggcgtgggaccgcgtcgacaacgatcccgacatccgctgttgcatc
ctgaccggtgctggtggctacttttgcgcgggcatggacctcaagaccgcaacccagaag
ccgccgggcgactccttcaaggacggcagctacgacccgtcgcgcatcgacgctctgctc
aagggtcgccgactcaccaagcccttgattgcagccgtcgaaggaccggcgatcgccggc
ggcaccgagatcctgcagggcaccgacatccgggtggccggcgagagcgccaagttcggc
atctccgaggccaagtggagcctgtacccgatgggtgggtcggccgtccgcttagtccgc
cagatcccctacgcggttgcgtgcgacctgctgctgaccggacgccacatcaccgcgacc
gaggccctcgagatgggcttgatcgggcacgtcgtcccggacggtcaggccttgaccaag
gcactcgaactcgccgagatcatcgagaacaacggccctctggcggtgcaggcaatcctg
cggaccatccgcgagaccgaaggtatgcacgagaacgaggcgttcaagatcgacacccag
atcggcattcaggtgttcctgtccgacgacgccaaggaaggcccccgggcgttcgccgag
aagcgcaagccggagttcaagaaccgctga

KEGG   Mycobacterium paragordonae: C0J29_27630
Entry
C0J29_27630       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_27630
   00650 Butanoate metabolism
    C0J29_27630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_27630
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_27630
   00310 Lysine degradation
    C0J29_27630
   00360 Phenylalanine metabolism
    C0J29_27630
   00380 Tryptophan metabolism
    C0J29_27630
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_27630
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_27630
   00281 Geraniol degradation
    C0J29_27630
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_27630
   00627 Aminobenzoate degradation
    C0J29_27630
   00930 Caprolactam degradation
    C0J29_27630
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_27630
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE97994
UniProt: A0A386UBI0
Position
6196650..6197408
AA seq 252 aa
MTITSTTTEPGIVAVTVDYPPVNAIPSQGWFELGDAITAAGRDPQTHAVILRAEGRGFNA
GVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNADVIV
ASDDAVFGLPEVERGALGAATHLSRLVPQHMMRRLFFTAATVDAATLHHFGSVHEVVPRA
ELDESALRVARDIAAKDTRVIRAAKEALNLIDVQRVNSSYRMEQGFTFELNLVGVADEHR
DAFAGTAKGKKE
NT seq 759 nt   +upstreamnt  +downstreamnt
atgacgatcacctccaccaccacagaacccggcatagtcgcggtcaccgtcgactatccg
cccgtcaacgccattccctcgcagggatggttcgaactcggcgacgcgatcacggccgcc
gggcgggatccacagacccacgcggtgatcctgcgcgccgaaggccgcggcttcaacgcc
ggcgtcgacatcaaggaaatgcagcggaccgaagggttcaccgcactgatcgacgcgaac
cgcggctgcttcgctgcgttccgcgcggtttacgaatgcgcggtcccggtcattgccgcg
gtgaacggcttctgcgtcggcggtggcatcggcctggtcggcaacgccgacgtcatcgtg
gcctccgacgacgcggtcttcggactccccgaagtggagcgcggtgccctcggcgcggcc
acccacttgtcccgcctggtcccgcagcacatgatgcggcggctcttcttcaccgccgcc
accgtcgacgccgccacgctgcaccacttcggctcggtacacgaggtggtgccgcgtgcc
gagttggacgaatccgcactccgggtggctcgcgatatcgccgccaaggacacccgcgtc
atccgggccgccaaagaggcgctgaacctgatcgacgtgcaacgcgtgaactcgagttac
cgcatggaacaagggtttacgttcgagctcaacctcgtcggcgtcgccgacgagcaccgc
gacgcgttcgccggaacggcaaagggcaagaaggaatga

KEGG   Mycobacterium paragordonae: C0J29_29420
Entry
C0J29_29420       CDS       T06847                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00281  Geraniol degradation
mpag00310  Lysine degradation
mpag00360  Phenylalanine metabolism
mpag00362  Benzoate degradation
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00627  Aminobenzoate degradation
mpag00640  Propanoate metabolism
mpag00650  Butanoate metabolism
mpag00903  Limonene and pinene degradation
mpag00930  Caprolactam degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01212  Fatty acid metabolism
Module
mpag_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C0J29_29420
   00650 Butanoate metabolism
    C0J29_29420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_29420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_29420
   00310 Lysine degradation
    C0J29_29420
   00360 Phenylalanine metabolism
    C0J29_29420
   00380 Tryptophan metabolism
    C0J29_29420
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_29420
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_29420
   00281 Geraniol degradation
    C0J29_29420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C0J29_29420
   00627 Aminobenzoate degradation
    C0J29_29420
   00930 Caprolactam degradation
    C0J29_29420
Enzymes [BR:mpag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C0J29_29420
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: AYE98289
UniProt: A0A386UDK3
Position
6549167..6549991
AA seq 274 aa
MGETYESVTVEIKDQVAQVTLIGPGKGNAMGPAFWSEMPDVFATLDADPDVRAIVITGLG
RNFSYGLDVPAMGGSFTPLLSGEALAGPRAVFHREVKRMQGAITAIADCRTPTIASVHGW
CIGGGVDLISAVDIRYASADAKFSVREVKLAIVADVGSLARLPLILNDGHLRELALTGKD
IDAARAEKIGLVNDVYDDAEATLAAAHATAAEIAANPPLTVHGIKDVLDQQRISAVSESL
RYVAAWNAAFLPSKDLTEGISATFAKRPPQFTGE
NT seq 825 nt   +upstreamnt  +downstreamnt
atgggcgaaacatacgaatccgtcaccgtcgagatcaaggaccaggtagcgcaggtgacg
ttgatcggtccgggcaagggcaacgcgatggggcccgccttctggtcggagatgccggac
gtgttcgcgacgctggacgccgatcccgacgtgcgcgccatcgtcatcaccgggttgggc
cggaatttcagctatggcctggacgtgccggccatgggcgggtcgttcaccccgctgctg
tccggtgaggccctggccggcccacgcgcggtctttcaccgcgaggtcaagcgcatgcag
ggcgctatcaccgccatcgccgactgccggaccccgacgatcgcctcggtgcacggctgg
tgcatcggcggcggggtcgacctcatctcggcggtcgacatccgctacgccagtgccgac
gccaagttctcggttcgtgaggtcaagctggccatcgtcgccgacgtgggcagcctcgcc
cgcctgccgctgatcctcaatgacgggcacctgcgcgaactcgcgctgaccggcaaagac
atcgacgccgcccgcgccgagaagataggcctggtcaacgacgtctacgacgacgccgag
gccacgctcgcggcggcccacgccaccgccgcggagatcgccgccaaccctccgctgacc
gtgcacggcattaaggacgtgctcgaccagcaacgcatctcggcggtgtcggagagcctg
cgctatgtcgcggcctggaacgcggccttcctgccgtcgaaggatctgaccgagggcatc
tcggcgacgttcgcgaagcgcccgccgcaattcaccggcgagtag

DBGET integrated database retrieval system