KEGG   Mycobacterium paragordonae: C0J29_02040
Entry
C0J29_02040       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_02040
   00053 Ascorbate and aldarate metabolism
    C0J29_02040
   00620 Pyruvate metabolism
    C0J29_02040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_02040
   00561 Glycerolipid metabolism
    C0J29_02040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_02040
   00310 Lysine degradation
    C0J29_02040
   00330 Arginine and proline metabolism
    C0J29_02040
   00340 Histidine metabolism
    C0J29_02040
   00380 Tryptophan metabolism
    C0J29_02040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_02040
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_02040
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_02040
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_02040
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_02040
SSDB
Motif
Pfam: Aldedh DUF6397 DUF1487
Other DBs
NCBI-ProteinID: AYE93762
UniProt: A0A386TZW3
Position
437771..439213
AA seq 480 aa
MTTDSLPKAATGPVNGQAAAQPSVADTVARLRKTFATGRTRSYEWRKRQLEQLTKLVEEN
EPAIAAALAEDLDRNHVEAFIADIATTAGEAKFAAKKLKKWMRRKYLLLEAPQLPGRGWV
EYEPYGTVLIIGAWNYPFYLTLGPAVGALAAGNAVILKPSELAPASSHLMAELVPKYLDK
DAVAVIEGDGMVSQELIAQGLDRVMFTGGTEIGRKVYEGAAPHLTPVTLELGGKSPVVVA
ADGDVDVAAKRIAWLKILNAGQTCVAPDYVLADASIRDELVDKIAASITKFRSQDNQDGM
RIVNERQFNRLKGYISEAQADGTSKVAVGGKCDESSLRIQPTVVVDPAQDGPLMQNEIFG
PILPVLTVKDLDEAISFINARPKPLSAYLFTKSKATRERFIREVPAGGMLINHLAFQVST
AKLPFGGVGSSGMGAYHGKWGFDEFSHRKSVLTKPTRPDFSAMIYPPYTERAFKLARKLF
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaccaccgattccctgccgaaggctgcaaccgggcccgtcaacgggcaagcggccgct
caaccgagcgtcgccgataccgttgcccggctccgcaagaccttcgccaccgggcgcacc
cgcagttacgagtggcgcaagcgtcaactggagcagttgacgaagctggtggaggagaac
gaacccgcgatcgccgcagcgctggccgaggacctggaccgcaaccatgtcgaggcgttc
atcgccgacatcgccaccacggctggcgaggcgaagtttgcggccaagaagctcaagaag
tggatgcggcgtaagtacctgctgctggaagctccccagttgcccggccgcggctgggtg
gagtacgagccgtacggcaccgtgctgatcatcggcgcctggaactacccgttctatctg
acgctaggtcccgccgtgggcgcgctggccgcgggcaacgccgtcattttgaagccgtcg
gagctggccccggcgtcgtcgcacctgatggccgaactggtgcccaagtacctggacaag
gatgcggttgcggtgatcgagggcgacggcatggtcagccaggagttgatcgcgcagggc
ctggaccgggtgatgttcaccggcggcaccgagatcggacgcaaggtgtacgagggtgcg
gcaccgcatctgactccggtgacgctggaactcggcggcaagagcccggtggtggtggcg
gccgacggtgacgtggacgtcgcggccaagcgcatcgcctggttgaagatcctcaacgcc
ggacagacctgcgtcgcgcccgactacgtgctggccgacgcctcgatccgggacgaactc
gtcgacaagatcgccgcttccatcaccaagttccgttcccaggacaaccaggacggcatg
cgcatcgtcaacgagcgccagttcaacaggttgaaaggctacatctcggaggctcaggcc
gacgggacgtcgaaggtggccgtcggcggcaaatgcgatgagtccagcctgcggatccag
ccaaccgtggtcgtcgaccccgctcaggacgggccgctgatgcagaacgagatcttcgga
ccgatcctgccggtgctcaccgtgaaggacctggacgaggcgatctccttcatcaacgcc
cggcccaagccgttgtcggcctacctgttcaccaagtcgaaggcgacccgcgagcgattc
atcagagaggtgcccgcgggtggcatgctgatcaaccacctcgccttccaggtgtcgacg
gccaagctgcccttcggcggtgtcgggtcctccggcatgggcgcctaccacgggaagtgg
ggcttcgacgagttcagccaccgcaagtcggtgctgaccaagccgacccgccccgacttc
tccgccatgatctacccgccctacaccgagcgggccttcaagttggcgcgcaagctcttc
tag

KEGG   Mycobacterium paragordonae: C0J29_02670
Entry
C0J29_02670       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_02670
   00053 Ascorbate and aldarate metabolism
    C0J29_02670
   00620 Pyruvate metabolism
    C0J29_02670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_02670
   00561 Glycerolipid metabolism
    C0J29_02670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_02670
   00310 Lysine degradation
    C0J29_02670
   00330 Arginine and proline metabolism
    C0J29_02670
   00340 Histidine metabolism
    C0J29_02670
   00380 Tryptophan metabolism
    C0J29_02670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_02670
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_02670
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_02670
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_02670
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_02670
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AYE93857
UniProt: A0A386U004
Position
complement(588772..590265)
AA seq 497 aa
MTTIKNDPTTKSDTTEYDKLFIGGKWTEPATAEVIEVHCPATGEYVGKVPLATAADVDAA
VAAARAAFDSGPWPTTPPKERAAVIAKAQQLLEERKELFAKLLADETGQPPMTIETMHWM
GSMGAMSFFAGPAADQVKWREIRNGSYGQTIVHREPIGVVGAIVAWNVPLFLAINKLGPA
LLAGCTVVLKPAAETPLTANALAEVFADAGLPEGVLSVVPGGIETGQALTSNPDVDLFTF
TGSSAVGKEIGKRAADMLKPCTLELGGKSAAIVLEDVDLASAVPMMVFSGIMNTGQACVG
QTRILAPRSRYDEIVDAVSAFVQALPVGPPSDPNAQIGSLISEKQRARVESYIAKGKEEG
ARVVCGGGRPEGLDNGFFVQPTVFADVDNKMTIAQEEIFGPVLSIIPYDTEEDAIKIAND
SVYGLAGSVWTTNVPKGIEISEKIRTGTYAINWYAFDPCCPFGGYKNSGIGRENGPEGVE
HFTQQKSVLMPMGYTVE
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacgacgattaagaacgacccgacgaccaagagcgacacgaccgaatacgacaagctg
ttcatcggcggcaaatggacggagccggcgaccgccgaggtcatcgaggtgcactgtccg
gccaccggcgaatacgtcggcaaggtgccgctggcgacggcggccgacgtcgacgccgcg
gtcgccgcggcccgcgccgcattcgacagcgggccgtggcccacgactccccccaaggaa
cgcgcggccgtcatcgccaaggctcagcaactgctcgaagagcgcaaggagctcttcgcc
aagctgctcgccgatgagaccgggcagccgccgatgaccatcgaaaccatgcactggatg
gggtcgatgggggcgatgagcttcttcgccgggccggcggccgaccaggtcaagtggcgc
gagatccgcaacggctcctacggccagaccatcgtgcaccgggagccgatcggcgtggtg
ggcgcgatcgtggcctggaacgtgccgctgttcctggcgatcaacaagctggggcccgcg
ctgttggccggctgcacggtggtgctcaagcccgcggccgaaacacctttgaccgcaaac
gctttggccgaggtattcgccgacgccggcctgcccgaaggggtgttgtcggtggtgccc
ggcggcatcgagaccgggcaggcactgacctccaaccccgacgtcgacctgttcaccttc
accggcagctccgcggtcggaaaggaaatcggcaagcgcgccgcggacatgctcaagccg
tgcaccctggagttgggcggcaagtcggcggcgatcgtgctcgaggacgtcgacctggcc
tcggcggttccgatgatggtgttctccgggatcatgaacaccgggcaggcgtgcgtcggg
cagacccgcatcctcgcgccgcgctcccggtacgacgaaatcgtagacgccgtaagcgct
ttcgtgcaggcgctgccggtaggaccgccgtcggacccgaacgcccagatcgggtcgctg
atctcggagaagcagcgtgcccgggtcgagagctacatcgccaaaggcaaagaggaaggc
gcccgggtggtgtgcggcggcggacggcccgagggactggacaacggattcttcgtgcag
cccacggtgttcgccgacgtcgacaacaagatgacgatcgcgcaggaggagatcttcggc
ccggtgctgagcatcatcccctacgacaccgaggaggacgcgatcaagatcgccaacgac
tcggtgtacggattggccggcagcgtgtggacgaccaacgtgcccaagggaattgagatc
tccgagaagatccgcaccggaacgtacgcgatcaactggtatgcgttcgacccctgctgc
ccgttcggcggctacaagaactcgggcatcgggcgggagaacgggcccgagggtgtcgag
cacttcacccagcagaagagtgtgctgatgccgatgggctacacggtcgagtaa

KEGG   Mycobacterium paragordonae: C0J29_15825
Entry
C0J29_15825       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_15825
   00053 Ascorbate and aldarate metabolism
    C0J29_15825
   00620 Pyruvate metabolism
    C0J29_15825
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_15825
   00561 Glycerolipid metabolism
    C0J29_15825
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_15825
   00310 Lysine degradation
    C0J29_15825
   00330 Arginine and proline metabolism
    C0J29_15825
   00340 Histidine metabolism
    C0J29_15825
   00380 Tryptophan metabolism
    C0J29_15825
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_15825
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_15825
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_15825
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_15825
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_15825
SSDB
Motif
Pfam: Aldedh DUF4880 Tape_meas_lam_C
Other DBs
NCBI-ProteinID: AYE96056
UniProt: A0A386U6A8
Position
3490632..3492065
AA seq 477 aa
MTSSTAQFFVDGQFRTADAAETVVEAATGEPLGEGAVVSESDIDAAVAGARRALPDWRNS
SPEHRAGILNAMADALKARAKATSELVTRENGMPIRLSRGANGAFPALLLRYYAQLVTEV
PVEEIRPSVTGHTIVRREAVGVVGAIVPWNYPQALAAMKVAPALAAGCTVVLKASPETAL
DALVFAEAAAEAGLPPGVLNVVSGGPAVGAALVSHPGVDKVAFTGSTATGRLVAETCGRL
MRPVTLELGGKSAAIILDDADLDATMRGLRNASFVNNGQTCHLSSRILAPKSRYDEVVDA
VAALAESMAVGDPLDPGTEIGPMVSSRQRERVLGYIDVGKSSGARLVAGGSIPKEQSRGW
FVAPTVFADVDNSDRLAREEVFGPVLTISAYDSDDEAVALANDTEFGLAGTVWSTDVDRA
TTVARAVHTGTIGVNDYALDVRAPFGGVKASGMGRELGPEGLEAYRTLKSIYRTGPA
NT seq 1434 nt   +upstreamnt  +downstreamnt
gtgacatcttcaaccgcacagtttttcgtggatggccagttccgcaccgccgacgccgcc
gaaacggtggtggaagccgcgaccggcgaaccgctcggcgagggcgccgttgtcagcgaa
tccgacatcgacgccgccgtcgccggcgcgcgccgggccctgccggactggcgcaacagt
tcacccgagcatcgcgccggaatcctgaacgccatggccgatgcgctcaaggcgcgcgcc
aaggcgaccagtgagctcgtgacgcgcgagaacggcatgccgatccggctgtctcgcggc
gccaacggcgccttcccggcgctgctgctgcggtattacgcgcaactggtcaccgaggtc
ccggtcgaggagatccggccgagcgtgaccgggcacacgatcgtgcgccgcgaggccgtc
ggggtggtgggcgcgatcgtgccgtggaactacccacaggcgctggccgccatgaaggtg
gcgcccgccctggccgcgggctgcaccgtggtgctcaaggcgtcacccgaaaccgctttg
gacgcattggttttcgccgaggccgcggcggaggccgggctaccgcccggggtgctcaac
gtggtgtcgggcggtccggccgtcggcgccgccctggtctcgcaccccggtgtcgacaag
gtcgcgttcaccggttccactgcgaccgggcgcctggtcgccgagacctgcgggcgtctg
atgcgcccggtcactcttgagttgggcggcaagtcagcggcgatcatcctcgacgacgcc
gacctggacgcgacgatgcgcggactgcgcaacgcctccttcgtcaacaacggccagacc
tgccacctgagctcacgcatcctggcgccgaaatcccgctatgacgaggtcgtcgacgcc
gtcgcggcgctggccgagagcatggcggtgggggacccgctggaccccggcaccgagatc
ggtcccatggtcagctcgcggcagcgcgagcgggtcctgggctacatcgacgtcggcaag
agcagcggcgcgaggttggtcgccggcggctcgataccgaaggaacagtcgcgcggctgg
ttcgtggcgccgaccgtgttcgccgacgtcgacaactccgaccggctggcccgcgaggag
gtcttcggcccggtgctgaccatcagcgcctacgacagcgacgacgaggccgtcgcgctg
gccaacgacacggagttcggcctggccggcaccgtctggtccaccgacgtcgaccgggcc
accaccgtcgcgcgggccgtgcacaccggcaccatcggcgtcaacgactacgcgctggac
gtgcgggcgccgttcggcggggtgaaggccagcgggatgggccgggagctgggtcccgag
ggcctggaggcctatcggacgctgaagtcgatctaccggacgggaccggcctga

KEGG   Mycobacterium paragordonae: C0J29_21625
Entry
C0J29_21625       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_21625
   00053 Ascorbate and aldarate metabolism
    C0J29_21625
   00620 Pyruvate metabolism
    C0J29_21625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_21625
   00561 Glycerolipid metabolism
    C0J29_21625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_21625
   00310 Lysine degradation
    C0J29_21625
   00330 Arginine and proline metabolism
    C0J29_21625
   00340 Histidine metabolism
    C0J29_21625
   00380 Tryptophan metabolism
    C0J29_21625
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_21625
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_21625
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_21625
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_21625
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_21625
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: AYE97005
UniProt: A0A386U9A3
Position
4828554..4830038
AA seq 494 aa
MSASLRSYDELFIGGRWRKPSNAERLSVISPHTEEPIAHVPAGTPDDVDAAVTAARRAFD
EGPWPRLRPQERMDKVGELAAIYGRHIEEMADLITAQMGSPRSFSRLGQAAGAASMIHLA
IAAARDFPWMERRQGVLGEAHLRRAPVGVVGAIVPWNVPQCLIMPKLIPALIAGCSVIIK
PAPETPLDALWLAEMIEHLELPEGVVSVVTGGPDVGEALVRHPGVDKVAFTGSSATGRRI
AALCGEQLKRVSLELGGKSAAIVLDDADIGKTVAGLKTAGLMNNGQACVAQTRILVSRDR
HDELVDALADMMSSLTVGDPTDEKTDIGPLVAQRQQRRVQDYIRSGQQQGARLVTGGADA
PAPRGWYVRPTLFTDATNDMRIAREEIFGPVLTVLTYTDEDEAVRIANDSDYGLAGSVWT
ADTAHGLDIAARVRTGTYGINMYMLDISTPFGGFKHSGIGREFGPEGLDEYVELQSVACN
GKLPPLNGVGEAAQ
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgtcggcaagccttcgttcctacgacgaactcttcatcggcggcaggtggcgcaaaccg
tcgaatgctgagcgtctgtcggtcatttctccgcacaccgaggagccgatcgcccacgta
cccgccggaactccggatgatgtcgacgccgccgtcaccgccgcccgtcgcgcttttgac
gaaggcccgtggccgcggctgcgaccgcaggagcggatggacaaggtcggagaactggcg
gcgatttacggccggcacatagaggagatggccgacctgatcaccgcgcagatggggtca
ccacgcagtttcagccggctcggtcaagcggccggggctgcctcaatgatccatctggca
attgcggccgcgcgcgattttccctggatggagcgccgtcagggcgtgctgggcgaggcg
cacctgcgtcgcgcgcccgtcggtgtggtcggggcgatcgtgccgtggaacgtaccccaa
tgcctgatcatgcccaagttgattcccgcgctgatcgccgggtgcagcgtgatcatcaag
ccggcgcccgaaacccctttggacgctttgtggttggccgagatgatcgaacacctcgag
ctgcccgaaggcgtcgtgtcggtcgtgaccggcggcccggatgtcggcgaggccctggtc
cggcatcccggcgtggacaaagtcgcgttcaccggctccagtgcaaccgggcgtcgcatc
gcggccctgtgcggcgaacagctgaaacgggtgagcctggaactcggtggcaagtccgcg
gccatcgtcctggatgacgccgacatcggcaagaccgtggccggactgaaaaccgccggc
ctgatgaacaatggccaggcctgcgtcgcgcagacccgcatcctggtcagccgagaccgt
cacgacgaactggtcgacgcactggctgacatgatgtcgagcctcaccgtcggtgatccc
accgacgagaagaccgacatcggaccccttgtcgcgcaacggcagcagcgccgggtgcag
gattacatccggtccgggcaacagcaaggtgcccgactggtgaccggcggcgcggacgct
ccggcgccgcgtggctggtacgtgcgcccgacgctgttcaccgacgccaccaacgacatg
cggatcgcccgcgaggagatcttcggccccgttctgacggtgctgacatacaccgatgag
gacgaggcggtacgaatcgccaacgacagcgactacggtctggccggctcggtgtggacc
gccgacaccgcacacggcctcgacatcgcggcgcgggtgcgcacaggcacctacggcatc
aacatgtacatgctcgacatcagcaccccgttcggcggcttcaagcactccgggatcggc
cgcgagttcgggcccgagggcctggacgagtacgtggagctgcagtcggtcgcctgcaac
ggaaagttgccgccgctcaacggggttggggaagctgcacagtga

KEGG   Mycobacterium paragordonae: C0J29_23295
Entry
C0J29_23295       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_23295
   00053 Ascorbate and aldarate metabolism
    C0J29_23295
   00620 Pyruvate metabolism
    C0J29_23295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_23295
   00561 Glycerolipid metabolism
    C0J29_23295
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_23295
   00310 Lysine degradation
    C0J29_23295
   00330 Arginine and proline metabolism
    C0J29_23295
   00340 Histidine metabolism
    C0J29_23295
   00380 Tryptophan metabolism
    C0J29_23295
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_23295
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_23295
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_23295
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_23295
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_23295
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: AYE97264
UniProt: A0A386U9J3
Position
complement(5215685..5217151)
AA seq 488 aa
MAELPPTGLIDTYQLYIDGRWVEPEDGRYDDISPSTEQVIATAPDASVGQVSDAVDAARR
AFDDGPWATMNAEQRGNCLSQLGDALLKYADDFFALSQVEWGCTANERMMQIDGAAFMSM
HAAQLATQLADETVTGIGAGKTVLRRVPLGVVSVLTPWNFPHLLNVMKLNHALTAGNTVV
LKPSPLTPLAGLALARIIDEHTDFPPGVINVVTPSGIEAAQLLTTDPRIDMVSFTGSTVV
GRQVMSAAGDSMKRLLLELGGKSACIVLDDAEITDDMLQQMLFDCCSMHSGQACILQSRL
LVPDSLHDDVVERLVALARAVQVGDPTDLDVQMGPLISDAQRGRVEAHVAAALRDGATLA
TGGGRPAGLDTGFYFEPTILTGVQPDSVIAQEEVFGPVLSVLRYRDDDDAVAIANNSSYG
LSGSVWGGDVDRAVGVARRIRTGQVAVNGCGPGAAPFGGFKLSGLGREGGGLGGVYQYME
QMAIGVPA
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggccgaactaccgcccaccggactgatcgacacctatcagctctacatcgacggccgt
tgggtggaacccgaagacggccgctacgacgacatctcgccgtccacggaacaggtcatc
gccaccgcgccggacgcgagcgtcgggcaggtcagtgacgcggtcgacgccgcgcgccgg
gcattcgacgacggcccgtgggccaccatgaacgcggagcagcgcgggaactgcctcagc
cagctcggcgacgcgctgctgaaatatgccgacgacttcttcgcgctgtcccaggtggaa
tggggctgcaccgccaacgaacgcatgatgcagatcgacggtgccgcgttcatgtccatg
cacgccgcccagctcgccacccaattggccgatgagacggtcaccgggatcggcgccgga
aagacggtcctgcgccgcgtgccactcggcgtcgtatcggtcctgacgccatggaacttc
ccgcacctgctcaacgtcatgaagctcaaccacgcgctgaccgcgggcaacaccgtcgtc
ctcaagccgtcaccactcacaccgctggccggcctggccctcgcgcgaatcatcgacgaa
cacaccgactttccacccggagtgatcaatgtcgtcaccccctcgggaatcgaggcggcc
caacttctcaccaccgatccgcggatagacatggtcagcttcaccggcagcaccgtcgtg
ggccgccaggtcatgtccgcagccggggactcgatgaagcggctgctactggaactcggt
ggcaagtccgcgtgcatcgttctcgacgacgccgagatcaccgacgacatgctgcagcag
atgctgttcgactgttgctcaatgcattccgggcaggcctgcatcctgcagagcaggctg
ttggtgcccgattcgctgcacgacgacgtcgtcgaacggctggtcgcgttggcccgggcc
gtgcaggtcggggaccccaccgacctcgacgtgcagatgggcccattgatcagcgacgca
cagcggggccgagtggaggcacacgtcgcagcggccctgcgggatggcgccacgctggcc
accggcggcggccggccggccggactggacaccggcttctacttcgagccgaccatcctc
accggcgtccagccggactccgtgatcgcccaggaagaagtgttcggccccgtcctgagc
gtgctgcgctaccgcgacgacgacgacgcggtcgccatcgccaacaactcgagttacggc
ctgtccgggtcggtgtggggtggtgacgtggatcgcgcggtcggtgtcgcccgccgcatc
cggaccgggcaggtcgcggtcaacgggtgcgggcccggtgccgcgccgttcggcggcttc
aagctcagtggtctgggccgggagggcggcggcctcggcggggtgtatcagtacatggag
cagatggcgatcggggttcccgcgtga

KEGG   Mycobacterium paragordonae: C0J29_23670
Entry
C0J29_23670       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_23670
   00053 Ascorbate and aldarate metabolism
    C0J29_23670
   00620 Pyruvate metabolism
    C0J29_23670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_23670
   00561 Glycerolipid metabolism
    C0J29_23670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_23670
   00310 Lysine degradation
    C0J29_23670
   00330 Arginine and proline metabolism
    C0J29_23670
   00340 Histidine metabolism
    C0J29_23670
   00380 Tryptophan metabolism
    C0J29_23670
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_23670
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_23670
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_23670
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_23670
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_23670
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AYE97330
UniProt: A0A386U9T1
Position
complement(5296095..5297579)
AA seq 494 aa
MADTVKVRFEPKMMIDGKLVDGQAGTFTNINPATEESLGEVADASKEDMHRAIDAARRAF
DETDWSTNRELRKRCLLQLHDAIEEEKEELREELILEVGSPRAITFGPQLDAPLQDGLKY
PARLIDDYPWETDLGDRVISLTGANTSIRQWREPVGVVGAIVPWNFPFEVTVNKLGQALG
TGNTVVLKPAPNTPFNATRLGRMIAEKTDIPAGVVNVVTASDHFVGEELTLSPKVDLISF
TGSTVVGKRIMEKGAATMKRLFLELGGKSATIVLEDADFGLACAIGIAPCMHAGQGCANP
TRMLLPRSRYDEGVAILKSIYENVTCGDPQDPGTLCGPVISERQRDRVMGYIRKGVEEGA
TALVGGPDAPTGFDKGFFVRPTLFVDVDNSMTIAQEEIFGPVLSVIPFDDEEDAIRIAND
SVYGLAGNVMSGSLEHSLAVARRIKAGFIGVNGGAPYGADVPFGGYKQSGVGRQNGIAGF
DQYTEIKSVGYPVG
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggctgacactgtaaaggtccggttcgagccgaagatgatgatcgacggcaagctcgtc
gacggccaggccggcacgttcaccaatatcaatccggccaccgaggagtccctcggtgaa
gtcgccgacgcctccaaggaagacatgcaccgggccatcgacgccgcccggcgcgccttc
gacgagaccgactggtcgaccaaccgcgagttgcgcaagcgctgtctgctgcagctgcac
gacgcgatcgaggaggagaaggaggagctgcgcgaggagctcatcctcgaggtcgggtcg
ccgcgcgcgatcaccttcggcccgcagctggacgccccgctccaagacgggctgaagtac
ccggcccggctcatcgacgactacccgtgggaaaccgatctcggcgaccgggtgatcagc
ctcaccggcgccaacacctccatcaggcaatggcgggagccggtgggtgtggtcggcgcc
atcgtcccgtggaacttcccgttcgaggtgactgtcaacaagctcggccaggcactgggc
accggcaataccgtcgtgctcaagccggcgcccaataccccgttcaacgccacccggctg
ggccggatgatcgccgagaagaccgacattcccgccggcgtggtcaacgtcgtcacggcg
tccgatcactttgtcggagaagagcttacgctgtcgcccaaggtcgacctgatctcattc
accggctcgacggtggtgggcaaacggatcatggaaaaaggcgcggccacgatgaagcgg
ctgttcctcgagctgggcggcaagtcggccaccatcgttctcgaagacgccgacttcgga
ctggcctgcgccatcggcatcgccccgtgcatgcacgccggtcagggctgtgccaacccc
acccggatgctgctgccgcggtcgcgctacgacgaaggtgtcgcgatcctcaagagcatc
tacgagaacgtcacctgcggtgacccccaggaccccggaaccctgtgcggcccggtgatt
tcggagcggcaacgcgaccgcgtcatgggctacatccgcaagggcgtcgaagaaggcgcc
accgcgctggtcggcgggccggacgcgcccaccggcttcgacaagggattcttcgtccgc
ccaacacttttcgtcgacgtcgacaactccatgaccatcgcgcaggaggagatcttcggc
ccggtgctctcggtcattccgttcgacgacgaggaggacgcgatccgcattgccaacgac
agcgtctacggcctggccggcaacgtgatgtcgggttcgctggagcactcgctggcggtg
gcgcgccggatcaaggccggcttcatcggcgtcaacggcggtgccccgtacggcgccgac
gtaccgttcggcggctacaagcagagcggcgtcggacggcagaacggcatcgccgggttc
gaccagtacaccgagatcaagtcggtgggctacccggtcggataa

KEGG   Mycobacterium paragordonae: C0J29_25900
Entry
C0J29_25900       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_25900
   00053 Ascorbate and aldarate metabolism
    C0J29_25900
   00620 Pyruvate metabolism
    C0J29_25900
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_25900
   00561 Glycerolipid metabolism
    C0J29_25900
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_25900
   00310 Lysine degradation
    C0J29_25900
   00330 Arginine and proline metabolism
    C0J29_25900
   00340 Histidine metabolism
    C0J29_25900
   00380 Tryptophan metabolism
    C0J29_25900
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_25900
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_25900
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_25900
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_25900
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_25900
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AYE97712
UniProt: A0A386UAY2
Position
complement(5819062..5820600)
AA seq 512 aa
MSVQDTAATQDAQVGDQPTRDGAESGAGPSRRLLIDGRLVATPKTFATVNPATGEVLGYA
PDAGVQEARQAIAAARRAFDTTDWSTDVEFRIRCLDQLHQALLDHAEELRELTIAEVGAT
RALTHGAQLDEPIGIVRFYADLLRTYEFSEDLGEKESRGMRHHRWVEKEAAGVVAAIIAY
NYPNQLALAKLPPALAAGCTVVLKGAPDTPLVTLALGELIANHTDIPPGVVNVLSSSDPA
VGEALTTSPDVDVVTFTGSTAVGRKIMAAASDTVKRVFLELGGKSAVIMLDDADFAGAAM
FAAFSMVTHAGQGCALTSRLLVPRKHHDEVVELIAQNFAKVRHGDPGDPKTYMGPLINER
QRDKVDGMVQRAVAAGATLVTGGKRLDPGYFYAPTLLTNVDPDSEIAQDEVFGPVLVVIP
FDDDDDAVRIANNSIYGLAGAVFSRDQDRALSVARRIRAGSFSVNGGNYFGADSPFGGFK
QSGVGREMGVAGLEEFLEGKTFAVPAARGANA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtcagtccaggacacggcggcgacccaggacgctcaagtgggcgatcaaccgacccgg
gacggcgctgagtccggcgccgggccgagccgcagattgctcatcgacggtcgactcgtg
gcaacgccgaagacgttcgcgaccgtcaatcccgctaccggggaagtgctcgggtatgcg
cccgacgcgggtgtccaggaggctcggcaggccattgccgcggcgcggcgtgccttcgac
accaccgactggtccaccgacgtcgagttccggatccgctgtctcgaccagctgcaccag
gcgctgctcgaccatgcggaggagttgcgcgagctgaccatcgccgaagtcggtgccacc
cgcgcgctgacccacggagcgcaactcgacgagccgatcggcatcgtccggttctacgcc
gacctgttgcgcacgtacgagttctccgaagacctcggtgagaaagagtcgcgcggcatg
cgccaccaccgctgggtggagaaagaagccgcgggagtggtcgcggcgatcatcgcctac
aactacccgaaccagctggcactggccaagctgccgcccgcgctcgccgccggctgcacg
gtggtgctcaagggggcgcccgacacgccgctggtcaccctggccctgggtgagctgatc
gccaaccacaccgacatcccgcccggtgtcgtcaacgtgctcagctcgtctgatccggcg
gtaggggaagcgttgaccaccagccccgacgtcgacgtggtgacgttcaccggatccacg
gcggtcgggcgcaagatcatggctgcggccagcgacaccgtcaaacgcgtcttcctggag
ctcggtgggaagtccgcggtgatcatgctcgacgacgccgacttcgccggcgctgccatg
ttcgccgcgttcagcatggtcacccacgccgggcagggctgcgcgctcacctcgcgcctg
ctggtgccgcggaagcaccacgacgaggtcgtcgagttgatcgcgcagaacttcgccaag
gttcgccatggcgacccgggcgatccgaaaacctatatgggaccgctgatcaacgagcgc
cagcgggacaaggtcgacggcatggtccagcgggccgtcgccgcgggcgccacgctggtc
accggcggcaagcggctggatcccggctacttttacgcgccgaccctgctcaccaacgtc
gacccggacagcgagatcgcccaggacgaggtgttcgggccggtgctggtggtgatcccg
ttcgacgacgacgacgacgcggtgcgcatcgccaacaactcgatctacggtttggccggc
gcggtgttcagtcgcgaccaggaccgcgccctgtcggtggcgcgccggattcgggccgga
tcgttttcggtcaacggcggcaactatttcggcgcggacagcccgttcggtggcttcaaa
cagtccggtgtcggccgggagatgggcgtggccggcctggaagagttcttggagggcaag
acgtttgccgtccctgcggcccgaggagcaaacgcgtga

KEGG   Mycobacterium paragordonae: C0J29_26950
Entry
C0J29_26950       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_26950
   00053 Ascorbate and aldarate metabolism
    C0J29_26950
   00620 Pyruvate metabolism
    C0J29_26950
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_26950
   00561 Glycerolipid metabolism
    C0J29_26950
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_26950
   00310 Lysine degradation
    C0J29_26950
   00330 Arginine and proline metabolism
    C0J29_26950
   00340 Histidine metabolism
    C0J29_26950
   00380 Tryptophan metabolism
    C0J29_26950
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_26950
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_26950
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_26950
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_26950
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_26950
SSDB
Motif
Pfam: Aldedh RRM_occluded PAS_8
Other DBs
NCBI-ProteinID: AYE97890
UniProt: A0A386UBA5
Position
complement(6033147..6034616)
AA seq 489 aa
MALLADGVSALFIDGKFSEGSAGTFPTANPATEEVLGVAADADAQDMGRAIDAARRAFDD
TDWSRNTELRVRCIRQLREAMQQHTEELRELTISEVGAPRMLTSMAQLEGPVNDLAFAAD
TAESYVWNQDLGQAAPMGIPTRRTIAREAVGVVGAITPWNFPHQINLAKLGPALAAGNTI
VLKPAPDTPWCAAVLGELIAEHTDIPPGVVNIVTSSDHSVGALLAKDPRVDMISFTGSTA
TGRSVMSDAAATIKKVFLELGGKSAFVVLDDADLAGACAMAGFTASMHAGQGCAITTRLV
VPRAHYDDAVAAAAGTMAGIKPGDPNDPGTVCGPVISARQRDRVQGYLDSAIAEGGTFAC
GGGRPAGRDVGYFIEPTVIAGLGNDARVAREEIFGPVLTVIAHDGDEDALRIANDSPYGL
SGTVFSADADRAARFASRMRVGTVNVNGGVWYSADAPFGGYKQSGNGREMGLAGFEEYLE
IKTIATSAS
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccctgttggccgacggcgtgagtgcactgttcatcgacggcaaattctcggaaggc
agcgcgggcaccttccccactgccaatccggctaccgaggaggtgctgggcgtagcggcg
gacgccgacgcacaagacatgggccgtgccatcgatgcggcgcggcgtgccttcgacgac
accgactggtcgcgcaacaccgaactgcgggtgcggtgcatccggcagttgcgcgaagcg
atgcagcagcacaccgaagagttgcgcgagctgacgatttccgaagtcggcgcgccgcgg
atgctcacctcgatggcccagctggagggtccggtcaatgacctcgcgttcgcggccgac
accgccgaaagctatgtctggaaccaggatctcgggcaggcggccccgatgggcatcccg
acccggcgcaccatcgcccgggaggcggtgggtgtcgtcggcgccatcacgccgtggaac
ttcccgcatcaaatcaaccttgccaagttgggtccggctctcgcggcgggcaacaccatc
gtgttgaagccggcgcccgacactccctggtgcgcggcggtactcggcgagctcatcgcc
gagcacaccgacattccgccgggcgtggtcaacatcgtcacctccagcgaccacagcgtg
ggcgcgttgctcgccaaagaccctcgggtggacatgatttcgttcaccggctccaccgcc
accggccgcagcgtgatgagtgacgcggccgccaccatcaagaaggtgttcctggaactg
ggtgggaagtcggcgtttgtggtgctcgacgacgccgatctggccggtgcgtgcgcgatg
gcggggttcaccgcgtccatgcacgccgggcagggctgcgcgatcaccacccgattggtc
gttccgcgggcgcactacgacgacgccgtcgcggcggcggcgggaaccatggcgggaatc
aagccgggcgatcccaatgatcccggaaccgtctgcggcccagtgatctccgcgcgccag
cgggaccgcgtgcagggctacctggactcggcgatcgccgagggcgggaccttcgcctgc
ggtggcggccggccggcgggacgcgatgtcggctactttatcgaacccaccgtgatcgcg
ggtctgggcaacgacgcccgggtggcccgcgaggagattttcgggcccgtgctcacggtg
atcgcgcatgacggtgacgaggacgcgctgcgtatcgccaacgactcgccatatggtctg
tccggcaccgttttcagcgcggacgcagaccgggccgcccggttcgcgtcgcggatgcgg
gttggcaccgtcaatgtcaacggcggtgtctggtactccgcggacgcgccgttcggcgga
tacaagcagtccggcaacggccgcgaaatgggcctggccgggttcgaggagtatctggaa
atcaaaaccattgcgacttcagctagttga

KEGG   Mycobacterium paragordonae: C0J29_30765
Entry
C0J29_30765       CDS       T06847                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00010  Glycolysis / Gluconeogenesis
mpag00053  Ascorbate and aldarate metabolism
mpag00071  Fatty acid degradation
mpag00280  Valine, leucine and isoleucine degradation
mpag00310  Lysine degradation
mpag00330  Arginine and proline metabolism
mpag00340  Histidine metabolism
mpag00380  Tryptophan metabolism
mpag00410  beta-Alanine metabolism
mpag00561  Glycerolipid metabolism
mpag00620  Pyruvate metabolism
mpag00625  Chloroalkane and chloroalkene degradation
mpag00770  Pantothenate and CoA biosynthesis
mpag00903  Limonene and pinene degradation
mpag01100  Metabolic pathways
mpag01110  Biosynthesis of secondary metabolites
mpag01120  Microbial metabolism in diverse environments
mpag01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C0J29_30765
   00053 Ascorbate and aldarate metabolism
    C0J29_30765
   00620 Pyruvate metabolism
    C0J29_30765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C0J29_30765
   00561 Glycerolipid metabolism
    C0J29_30765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C0J29_30765
   00310 Lysine degradation
    C0J29_30765
   00330 Arginine and proline metabolism
    C0J29_30765
   00340 Histidine metabolism
    C0J29_30765
   00380 Tryptophan metabolism
    C0J29_30765
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C0J29_30765
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    C0J29_30765
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_30765
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C0J29_30765
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C0J29_30765
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AYE99352
UniProt: A0A386UFG7
Position
unnamed1:complement(118516..119976)
AA seq 486 aa
MTTIDYPQLYIGGTWSAPAGHDTIEVHSPTTEERIGSVPRGKEADIDAAVAAARTAFDAP
DGWANWDPKERADVLEKFAAELEARGAETARRVSMQNGMPIWLAHQFEAGFPALLVRYYS
GLMTSAPVEDARPGMFGGTALVSKEPVGVVGAIVPWNVPQGISFLKIAPALAAGCTMVLK
PAEETVLDAFLMAEAAAAAGLPDGVLNVVPGGREVGAYLVEHPGVDKVSFTGSSAAGRWI
AEACGRLLRPVTLELGGKSAAIVLDDANLAASIEQFFGVTLLNNGQICWLNSRVLVPRSR
YSEIVDTITDLARSLTVGDPLDPETKVGPLVSERQRERVEGYIAKGKSEGARMTTGGSRP
FDKGWFLEPTIFADLDNNATVSREEIFGPVLSLIPYSDEDEAVAIANDSIYGLGGSVWSS
DPERAVNVARRVRSGTVGVNHYVNDPVAPFGGVKQSGMGRELGPEGLHAFQVSKTIYLPP
PPGAGE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgacaacgatcgattacccgcagctgtacatcggcggcacgtggagcgcgcccgccggc
cacgacaccatcgaggtccactctccgacgaccgaggaacggatcggttcggtgccccgc
ggcaaagaggccgacatcgacgcggctgtcgcggcggccaggacggcattcgacgccccc
gacggatgggcgaactgggatcccaaagagcgcgctgatgtgctcgagaagttcgcggcg
gaactggaagctcgcggcgccgaaacagcacggcgggtttcgatgcagaacgggatgccg
atctggctggcccaccagttcgaggccggttttccggcgctgctggtgcgctactacagc
ggcctgatgaccagtgcaccggtcgaggacgcgcgtcccggcatgttcgggggcaccgcg
ctggtttctaaggagcccgtcggcgtcgtcggcgcgatcgtgccctggaatgtgccacaa
gggatttcgttcctcaagatcgcacccgcgctggccgccggctgcacgatggtcctcaag
cccgccgaggaaaccgtgctcgacgcattcctcatggccgaggccgcggcggcggccggt
ctacccgacggtgtgctcaacgtggttcccggcggccgcgaggtgggcgcctatctggtc
gagcaccccggggtggacaaggtgtcgttcaccggctccagcgccgcaggccgctggatt
gccgaggcatgcggacgcttgttgcggccggtcaccctcgagctcggcggcaaatctgcg
gcgatcgtgctcgacgacgccaacctggccgcctcgatcgaacagttcttcggggtcacc
ctgctcaacaacgggcagatctgttggctcaactcccgggtgctggtccctcgcagccgg
tattccgagatcgtcgacacgataaccgatttggcgcgatcgctgacggtgggcgatccc
ctcgaccccgaaaccaaggtcggcccgctggtttcggagcgccaacgcgagcgcgtcgag
gggtatatcgccaaaggcaagagtgaaggcgcccgaatgaccaccggcggttcgcgaccg
tttgacaagggctggttcctggaacccaccatcttcgcggacttggacaacaatgcgacc
gtgtcacgtgaagagatcttcggtccggtgctgtcgctgattccatactccgacgaggac
gaggcggtcgcaatcgccaacgacagcatctacggcctgggcggtagcgtgtggtcatcg
gatcccgaacgcgcggtcaacgttgcccgccgcgttcgctccgggactgtcggggtcaac
cactacgtcaacgaccccgtcgcacccttcggcggcgtcaagcaaagcggcatggggcgc
gaactcggtccggaggggttgcacgcgtttcaggtctccaagaccatttacctgccgcct
ccgcctggcgccggggaataa

DBGET integrated database retrieval system