KEGG   Mycobacterium paragordonae: C0J29_08750
Entry
C0J29_08750       CDS       T06847                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
mpag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_08750
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     C0J29_08750
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DUF1776
Other DBs
NCBI-ProteinID: AYE94854
UniProt: A0A386U2W1
Position
complement(1880754..1881599)
AA seq 281 aa
MAENRVGRVAGKVALITGAARGQGREHAIRLAEEGADIVAVDVCADIDGVAYPGATDSDL
ADTADLVEKSGRRIVTAKADVRDVEALRAAVAQGVDALGPLDIVVANAGISGVPAPAAMI
EESAWQTMMDINLTGVWHTVKVALPHMTNGGGSIILVSSMLGIRGGGYMAHYASAKHAVV
GLMNSLANELAPQWIRVNSIHPGNILTPMLDNDWFVRTLRPDLPNPTVQDAGEIIGQFHL
LPKPLIEARAVSNAVLFLASDESQYITGAALPVDAGAVAKF
NT seq 846 nt   +upstreamnt  +downstreamnt
atggcagagaacagggtcggcagagtcgccggcaaggtcgcattgatcaccggcgcggca
cgcggccaagggcgcgaacacgcgatccgattggccgaagagggcgccgacatcgtcgcg
gtcgacgtctgtgcggacatcgacggcgtcgcttacccgggagcgaccgacagcgacctc
gccgacaccgcggacctggtggagaagtcgggccgccgcatcgtcaccgcgaaagccgac
gtgcgggacgtggaggcgttgcgggccgcggtcgcgcagggagtggacgcgttgggtcca
ctcgacatcgtggtggcgaacgccggcatcagcggggttcccgcacccgcggcgatgatc
gaagaatccgcgtggcagacgatgatggacatcaacctgaccggcgtgtggcacaccgtc
aaagtggcgctgccgcatatgaccaacggcggcggttcgatcatcctggtcagctcgatg
ttgggcattcgcggcggtggttacatggcccactacgcctcggccaagcacgccgtcgtc
ggcctgatgaactcgctggccaatgagcttgcgccgcaatggatccgggtgaactcgatt
catccgggcaacattttgacgccgatgctggacaacgactggttcgtccggacgctgcgg
ccggacctgcccaaccccaccgtgcaggatgccggcgagatcatcggacagtttcacctg
ttgcccaagccgctgatcgaggcacgcgccgtcagcaacgccgtgctcttccttgcctcc
gacgagtcgcagtacatcaccggggcggcgctgccggtcgatgcgggcgccgtcgcgaag
ttctga

KEGG   Mycobacterium paragordonae: C0J29_09015
Entry
C0J29_09015       CDS       T06847                                 

Definition
(GenBank) SDR family mycofactocin-dependent oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
mpag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_09015
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     C0J29_09015
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: AYE94900
UniProt: A0A386U2V4
Position
complement(1924062..1924895)
AA seq 277 aa
MPGRVADKVAFVTGAARGQGRSHAVRLAQEGADIIAVDICRPFENSPAPAATPEDLAETA
DLIKGLDRRVVTAEVDVRDYDALKAAVDSGVEQLGRLDIVIANAGIGTGGVRLDRMGEDL
WQEMIDVNLTGVWKSVKAAVPHLLSGGGGSIVLTSSVAGLKSYAHTGHYVAAKHGVVGLM
RSFAVELGPRNIRVNSVHPTHVNTPLLINETTFRLFRPDLENPGPDDLAPICQSFHTLPI
PWVNAEDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcccggccgagtagcagacaaggtcgcattcgtcaccggagcggcccgcggccagggc
cgtagccatgcggtgcggctggcgcaggaaggtgccgacatcatcgccgtcgatatctgc
cggccgttcgagaactctccggcaccggcggcgacaccggaagatctcgctgaaaccgcc
gatctgatcaagggtcttgaccgccgggtggtcaccgccgaggtcgacgtccgcgactat
gacgcgctcaaggccgccgtcgacagcggggtcgagcaactcggccgcctggacatcgtc
atcgccaatgccgggatcggcaccggcggtgtgcggctggaccggatgggtgaagacctg
tggcaggagatgatcgacgtcaacctcacgggtgtctggaagtcggtgaaagccgctgtg
ccgcatctgctttccggcggtggcggttcgatcgtgctgaccagctcggtggccggcctg
aaatcctatgcccacaccggtcactacgtggcggccaagcacggtgtggtcgggctgatg
cggtcgttcgccgtcgagctcggcccgcgcaacatccgggtcaattcggtacacccaacc
catgtgaatacgcccctgctgatcaacgagaccacattccggctgtttcggcccgatctg
gagaatccgggacccgatgatctggctccgatctgccagagcttccacaccctgccgatc
ccctgggtcaacgccgaggacatcagcaacgcggtgctgtttctggcctccgacgaggcg
cgctacatcaccggcgtcactctgcccgtggacgcgggaagttgcctgaagtag

KEGG   Mycobacterium paragordonae: C0J29_26130
Entry
C0J29_26130       CDS       T06847                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
mpag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_26130
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     C0J29_26130
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: AYE97754
UniProt: A0A386UAV5
Position
5861968..5862807
AA seq 279 aa
MTGRVEGKVAFVTGAARGQGRSHAVRLAQEGADIIAVDVCKPIVKNTTIPASTPEDLAET
ADLVKGLNRRIVTAEVDVRDFDALKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDKTSEY
DWQEMIDVNLSSVWKSVKAGVPHILAGRNGGSIILTSSVGGIKAYPHCGSYVAAKHGVVG
IMRSFAVELGQHMIRVNSVHPTHVATPMLHNEGTFKMFRPDLENPGPDDMAPICQMFHTL
PIPWVEAQDVSNAVLFFASDESRYITGVTLPVDAGSCLK
NT seq 840 nt   +upstreamnt  +downstreamnt
atgactggacgtgtagaaggtaaggtcgccttcgtcaccggggcggcgcggggccagggg
cgcagccacgcggtgcgattagcccaggaaggcgccgacatcatcgccgtcgacgtatgc
aagccgatcgtcaagaacaccaccatcccggcgtcgacacccgaggatctggccgagacc
gcagatctcgtcaagggcctcaaccgacggatcgtcacagcagaggtcgatgtacgcgac
ttcgacgcgctcaaggccgccgtggacagcggcgtcgagcaactggggcgactggacatc
atcgttgccaacgccggcatcggcaacggtggcgacaccctggacaagaccagcgaatac
gactggcaggagatgatcgacgtcaacctgtccagcgtctggaagtcggtgaaagccggc
gtgccgcatatcctggcgggccgcaacggtggctcgatcatcctcaccagctcggtcggc
gggatcaaggcctacccgcactgcggcagctatgtggccgccaagcacggcgtggtgggc
atcatgcgctccttcgcggttgaactggggcagcacatgattcgggtcaactccgtgcat
cccacgcatgtcgccaccccgatgctgcataacgagggcaccttcaagatgttccggccg
gacctggagaatcccggaccggacgacatggccccgatctgccagatgttccacacgctg
ccgatcccgtgggtcgaggcgcaggacgtcagcaacgccgtgctgttcttcgcctccgac
gagtctcggtacatcaccggcgtcaccctgccggtagatgcggggagctgcctcaaatag

DBGET integrated database retrieval system