KEGG   Mycobacterium paragordonae: C0J29_11310
Entry
C0J29_11310       CDS       T06847                                 

Definition
(GenBank) limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_11310
Enzymes [BR:mpag01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     C0J29_11310
SSDB
Motif
Pfam: LEH SnoaL_2 SnoaL SnoaL_3 DUF4440
Other DBs
NCBI-ProteinID: AYE95291
UniProt: A0A386U4W2
Position
complement(2438058..2438510)
AA seq 150 aa
MTELTQKGPASGAETTDNIRAVEDFLNALQAEDFDTVDALLHDNLVYENVGFSRIRGGRK
TTALLSKMQGRIGFEVKIHRIAADGSAVLTERTDALILGPLRLQFWVCGTFELHDGRITL
WRDYFDSFDMLKATLRGLAGLVVPSLRATL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgactgagctgactcagaaggggcccgcatccggagccgaaaccaccgacaacatccgc
gctgtcgaggatttcctcaacgccctgcaggccgaggacttcgacaccgtcgacgcgttg
ctgcacgacaatctcgtctacgagaacgtcggattctcccggatccgcgggggccggaag
acgacggcactgctgagcaagatgcagggccggatcggcttcgaggtgaaaatccaccgc
atcgccgccgacggttccgccgtgctcaccgagagaaccgacgcgctgatcctgggcccg
ctgcggctgcagttctgggtctgcggcacattcgagctgcacgacgggcggatcacgctc
tggcgggattacttcgacagcttcgacatgctgaaggcgacgctgcgcgggttggccggc
ctggtggttccgtcgctgcgcgcgaccttgtag

KEGG   Mycobacterium paragordonae: C0J29_16425
Entry
C0J29_16425       CDS       T06847                                 

Definition
(GenBank) limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_16425
Enzymes [BR:mpag01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     C0J29_16425
SSDB
Motif
Pfam: LEH SnoaL_2 SnoaL
Other DBs
NCBI-ProteinID: AYE96155
UniProt: A0A386U6U8
Position
complement(3620914..3621306)
AA seq 130 aa
MTETTENSEQIVRDFLGSWGSRNLDTICDGFADDAVYHNVPVQPIEGIDGIRAVFQGFLD
AFSAAKLDVVSLAAAPGLVLAERIDYFTMNDGRKVVLPVTGVFEVKNGKITRFSDYFDLA
DFEAQSGLRL
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaccgaaaccacggaaaacagtgagcagatcgttcgtgacttcctcgggtcctggggg
tcgcgcaacctcgacacgatctgcgacggctttgccgacgacgcggtctatcacaacgtc
ccggtccagccgatcgagggcatcgacggcatccgcgccgtgttccaaggttttctggac
gcgttctccgctgccaaactcgatgtggtctcgttggcggcagcgcccggtctggtgctg
gccgagcgcatcgactacttcaccatgaacgacggtcgcaaagtcgtgctgccggtcacc
ggcgttttcgaagtcaagaacggcaagatcacccgcttcagtgactacttcgacctggcg
gacttcgaagcacagagcggcctgcggctctag

KEGG   Mycobacterium paragordonae: C0J29_20085
Entry
C0J29_20085       CDS       T06847                                 

Definition
(GenBank) limonene-1,2-epoxide hydrolase
  KO
K10533  limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_20085
Enzymes [BR:mpag01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     C0J29_20085
SSDB
Motif
Pfam: LEH SnoaL_2 DUF3696 SnoaL
Other DBs
NCBI-ProteinID: AYE98988
UniProt: A0A386UFC1
Position
4441680..4441982
AA seq 100 aa
MPAFTGPDAIVENMAGQFSMFPESYAFEIVNLASDGPVVLTERLDYIQAPDGSKPAIPVM
GTFVVDDDGRITRWTDYFDLNLIMKLLQDEDISGLVPATT
NT seq 303 nt   +upstreamnt  +downstreamnt
atgcccgccttcaccggaccggatgccattgtggagaacatggccggccagttttcgatg
ttcccggagtcctacgccttcgaaatcgtcaacctcgccagcgatggtcccgtggtgctc
accgaacgcctggactacattcaggctcctgacggaagtaagccggccatcccggtgatg
gggaccttcgtcgtcgacgacgacgggaggatcactcgctggaccgactatttcgacctg
aatctgatcatgaagctcctgcaagacgaggacatcagcggcctggtgcccgcgacgaca
tga

DBGET integrated database retrieval system