KEGG   Mycobacterium paragordonae: C0J29_16250
Entry
C0J29_16250       CDS       T06847                                 

Definition
(GenBank) LLM class flavin-dependent oxidoreductase
  KO
K14733  limonene 1,2-monooxygenase [EC:1.14.13.107]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_16250
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.107  limonene 1,2-monooxygenase
     C0J29_16250
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-ProteinID: AYE96126
UniProt: A0A386U6G8
Position
3586870..3588033
AA seq 387 aa
MAKLRFGYFIAPFHRAGTNPTLALQRDLEFVEHLDALGFDEAWIGEHHSAGSEIISSPEV
FIGAAAQRAKRIRFGTGVISLSYHNPLWVADRLMLLDHLTHGRIIGGVGPGSLPTDSSMI
GLTPTDTRELLETNLDIVVRLLAGETVSAKTATHQLYDAKLQLAPYSDGGIPLAVAAVAS
PTGARLAGKHGIGLLSIGATLTIEGFDALAYHWGIVEERAQAFGTQVDRSNWSLVGPMHI
AETDEQARADVKFGIEPWFRYFQKVAAFPQMTMPGDRLDEMIDMINDNGAGVIGTPERAR
EQVQRLWDQSGGFGCMLQMGHEWANPAATRRSAELFAAEVMPHFQGQGQPTLDAATRAGQ
MRDDLAATQLQAIEHMTKKYQDELSAK
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcgaagctcaggttcggatacttcatcgccccttttcaccgcgccggcaccaacccg
acgctcgccctgcaacgtgacctggagttcgtcgagcacctcgacgcgctcggtttcgac
gaggcgtggatcggcgagcatcactccgccggcagcgaaatcatcagctccccggaggtg
ttcatcggcgctgcggcccagcgcgccaagcgaattcgattcggcacgggcgtaatctcg
ctgtcgtaccacaacccactctgggttgccgaccggttgatgctgctcgatcacctcacc
cacggccgcatcatcggcggggtcgggccgggctcgctgcccaccgactcgtcgatgatc
ggactgactcccaccgacacccgcgagttgctggaaaccaatctcgacatcgtcgtccgc
ctgctggcgggggagaccgtctccgccaagaccgccacccatcagctttatgacgcgaaa
ctgcaacttgctccctattccgacggcgggattccgctggcggtggcggcggtcgcatca
ccgaccggtgcccgcctggccggcaagcacggcatcggcctgctgtcgatcggcgccacg
ctgaccatcgaaggcttcgacgcgctggcctaccactggggcatcgtcgaagagcgagcc
caggccttcggcacccaagtcgatcggagcaactggagtctggtgggccccatgcacatc
gcggaaaccgacgagcaggcccgcgccgacgtgaagttcggcatcgagccctggttccgc
tacttccagaaggtcgccgccttcccgcagatgacgatgccgggggatcggctcgacgaa
atgatcgacatgatcaacgacaacggcgccggagtcatcggcacgccggaacgggcacgc
gaacaggtgcagcggttgtgggatcagtcaggcggtttcggctgcatgctgcagatgggt
cacgagtgggcgaatccggccgcgaccagacgctcagccgaactgttcgccgccgaagtg
atgccgcattttcagggccagggacaacccacgctcgacgctgcgacgcgcgccgggcag
atgcgcgacgacctggccgccacccagctgcaggccatcgagcacatgaccaagaagtac
caggacgagctcagcgcgaagtag

KEGG   Mycobacterium paragordonae: C0J29_28115
Entry
C0J29_28115       CDS       T06847                                 

Definition
(GenBank) LLM class flavin-dependent oxidoreductase
  KO
K14733  limonene 1,2-monooxygenase [EC:1.14.13.107]
Organism
mpag  Mycobacterium paragordonae
Pathway
mpag00903  Limonene and pinene degradation
Brite
KEGG Orthology (KO) [BR:mpag00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C0J29_28115
Enzymes [BR:mpag01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.107  limonene 1,2-monooxygenase
     C0J29_28115
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-ProteinID: AYE98083
UniProt: A0A386UBR2
Position
6295975..6297165
AA seq 396 aa
MVSAPMRFGVFITPFHPTGQSPTVALEYDMERVVALDRLGYDEAWFGEHHSGGYELISCP
EVFIAAAAERTKHIRLGTGVVSLPYHHPLMVADRWVLLDHLTRGRVMFGTGPGALPSDAY
MMGIDPVDQRRMMQESLEAILALFRAAPEERIDRHTEWFTLRDAQLHIRPYTWPYPEIST
AAMISPSGPRLAGALGTSLLSLSMSVPGGFAALENTWDVVCEQAAKAGRAEPDRTDWRVL
SIMHIADTRDQAIEDCTYGLMDFAKYFGAAGFVPLSNTVEGAQSPREFVEDYAAKGNCCI
GTPEDAIAHIEDLLDRSGGFGTLLLLGHDWASPQATFHSYDLFARKVIPHFKSQLEAPRA
SHEWAKDKREELIGRAGQAVVQAITQHVAEHDKAAN
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggtaagtgcaccaatgcgattcggcgtcttcatcacgccgtttcatccgaccgggcaa
tcgccgacagtggcgctggagtacgacatggaacgggtcgtggcgctggaccgcctgggc
tacgacgaggcgtggttcggcgaacaccattccggcggctacgaattgatctcctgcccg
gaggttttcatcgcagccgccgccgaacgcaccaaacacatccgcttgggcaccggggtg
gtctcgctgccgtaccaccatccgctgatggtggccgaccgctgggtgctgttggatcac
ctgacccggggccgtgtcatgttcggcaccggaccgggcgcgctgccgtccgacgcctac
atgatgggcatcgacccggtcgaccagcgccgcatgatgcaggaatccctggaggcgatt
ctggcgctgttccgcgccgcacccgaggaacgcatcgaccgtcacaccgaatggttcacg
ctgcgcgatgcccagttacacatccgcccctacacctggccgtatcccgagatatccacc
gccgcaatgatctcgccgtccggcccgcgactggccggcgcgctgggcacctcgctgctg
tcgctgtcgatgtcggtgcccggcggatttgcggctttggagaacacctgggatgtggtg
tgcgagcaggccgcgaaggcaggccgagcagagccggaccgcactgactggcgcgtcctg
agcatcatgcacatcgccgacacgcgcgatcaggcgatcgaagactgcacttacgggttg
atggacttcgcgaagtacttcggggccgcgggcttcgtgccactgtccaacaccgtcgag
ggcgcgcagtccccacgcgagttcgtcgaagactatgcggccaagggcaattgctgtatc
ggaacccccgaggatgcgatcgctcacatcgaagacctgttggatcgctcgggcggcttc
ggcaccctgctgttgctcggtcatgactgggcgtcgccacaggcgaccttccactcgtat
gatcttttcgcccgcaaggtgattccgcacttcaagagccagctcgaagcgccccgcgcc
tcgcacgaatgggccaaggacaagcgcgaggagttgatcgggcgggccggtcaggccgtc
gtgcaggcgatcacccagcacgtggccgaacacgacaaggcggccaattga

DBGET integrated database retrieval system