KEGG   Mus pahari (shrew mouse): 110312894Help
Entry
110312894         CDS       T05929                                 

Gene name
Acads
Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00071  Fatty acid degradation
mpah00280  Valine, leucine and isoleucine degradation
mpah00410  beta-Alanine metabolism
mpah00640  Propanoate metabolism
mpah00650  Butanoate metabolism
mpah01100  Metabolic pathways
mpah01200  Carbon metabolism
mpah01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    110312894 (Acads)
   00650 Butanoate metabolism
    110312894 (Acads)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110312894 (Acads)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110312894 (Acads)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110312894 (Acads)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     110312894 (Acads)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 110312894
NCBI-ProteinID: XP_021042494
Ensembl: MGP_PahariEiJ_G0024194
Position
23
AA seq 412 aa AA seqDB search
MAASLLARARGPLRRALRVRDWRRLHTVYQSVELPETHQMLRQTCRDFAEKELVPIAAQL
DREHLFPTAQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRGCASTGVIMSVNN
SLYLGPILKFGSAQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREEGDSWVLN
GTKAWITNSWEASATVVFASTDRSRQNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTAN
LIFEDCRIPKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRNAF
GAPLTKLQNIQFKLADMALALESARLLTWRAAMLKDNKKPFTKESAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccttgctcgcccgggcccgtggccctctccgcagagccctccgcgttcgg
gattggcgaaggttacacaccgtttaccagtctgtagagctccctgagacacaccagatg
ttgcgtcagacatgccgagactttgctgagaaggagctggtccctattgcagcccagctt
gacagggagcatctcttccccacagctcaggtgaagaagatgggtgagctcgggctgctg
gccatggatgtgccggaggagctgagcggtgcgggcctcgattacctggcctactccatc
gccctggaggagataagccgcggctgcgcctccacgggagttatcatgagcgtcaacaac
tctctctacttgggacccatcctgaagtttggatccgctcagcagaagcaacagtggatc
acccctttcaccaatggtgacaaaatcggctgttttgccctcagtgagccaggcaacggt
agtgatgctggagccgcttccaccactgcccgggaagagggtgactcgtgggtcctcaac
ggcaccaaagcctggatcaccaactcctgggaggcttccgccacggtggtgtttgccagc
acagacaggtcccggcagaacaagggtatcagtgccttcctggttcccatgccaactcct
gggctcacgctgggcaagaaggaagacaagttgggtatccgggcctcctccacagctaac
ctcatctttgaggactgccgcatccccaaggagaacctgctcggggagcctgggatgggc
ttcaaaatagccatgcaaaccctagacatgggtcgcattggcatagcctcccaggctcta
ggcatcgcccaggcctcgctggactgcgctgtgaaatatgccgagaaccgcaacgccttc
ggggcaccgctcaccaagctccaaaacatccagttcaagctggcagacatggccctggct
ctggagagtgcccgcctgctgacctggcgcgctgccatgttgaaagacaacaagaagcct
ttcaccaaggagtccgccatggccaagctggctgcatcggaggctgccaccgccatcagc
caccaggccatccagatcctgggcggcatggggtacgtgaccgagatgccagctgagcgg
tactaccgagatgcccgcatcactgaaatctacgaagggaccagcgaaatccagagactg
gtgatcgctgggcatctgctccggagctaccggagctga

DBGET integrated database retrieval system