KEGG   Mus pahari (shrew mouse): 110313642Help
Entry
110313642         CDS       T05929                                 

Gene name
Phf6
Definition
(RefSeq) PHD finger protein 6
  KO
K23310  PHD finger protein 6
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110313642 (Phf6)
   03009 Ribosome biogenesis [BR:mpah03009]
    110313642 (Phf6)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110313642 (Phf6)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    110313642 (Phf6)
Ribosome biogenesis [BR:mpah03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   110313642 (Phf6)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    110313642 (Phf6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 110313642
NCBI-ProteinID: XP_021043750
Ensembl: MGP_PahariEiJ_G0031613
Position
X
AA seq 364 aa AA seqDB search
MSSSIEQKKGSTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNE
SLGGFSIEDVQKEIKRGTKLMCSLCYCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPS
QGIYMVYCRKHKKTAHNSEADLEESFNEHELEPSSPKTKKKSRKGRPRKTNLKGLVEDTR
STSSHGTDEMESSSYRDRSPHRSSPNDTRPKCGFCHVGEEENEARGKLHIFNAKKAAAHY
KCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVKT
YHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGRVAIDQQLTQQQ
LNGN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcaattgaacagaagaaagggtctacaagacagcgtaaatgtggcttttgt
aagtcaaatagagacaaggaatgtggacagttactgatatctgaaaaccagaaggtggca
gcacaccacaagtgcatgctattttcgtctgctttggtatcctcacattctgataatgag
agtcttggtggattttcgattgaagatgtccaaaaggaaattaaaagaggcacaaagctg
atgtgttctctttgttattgtcctggagcaaccattggctgtgatgtgaagacctgccac
aggacataccactaccactgtgcattgcatgataaagctcagatcagagagaaaccttca
caagggatttacatggtctattgtcgaaaacacaagaaaactgcacataactctgaagct
gatttagaagaaagttttaatgagcatgaactggagccctcatctccaaagactaagaag
aaaagtcgcaaaggaagaccaagaaaaactaaccttaaaggtctggtggaagacaccaga
tccacatcctcccatggaacagatgaaatggaaagtagttcctatcgagataggtctcca
cacaggagcagtcctaatgataccaggcctaaatgtggattttgccatgtaggagaggaa
gaaaatgaagcaagagggaaattgcatatatttaatgccaagaaggcagccgcacattac
aagtgcatgttgttttcttctggcactgtccagctcacaacaacatcaagagcagaattt
ggagatttcgatatcaaaactgtacttcaggagattaagagaggaaaacgaatgaaatgt
acactttgcagtcagcctggtgctactattggatgtgaaataaaagcctgtgttaaaaca
taccattaccactgtggtgtacaagacaaggcaaaatacattgaaaatatgtcacgagga
atttacaaactctattgtaaaaatcatagtggaaatgatgagcgagatgaagaagatgag
gagcgagagagtaaaagccgtggaagagtagcgattgatcagcagctaacccagcagcag
cttaatggaaactag

DBGET integrated database retrieval system