KEGG   Mus pahari (shrew mouse): 110313831
Entry
110313831         CDS       T05929                                 

Gene name
Apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110313831 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110313831 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 110313831
NCBI-ProteinID: XP_021043901
Ensembl: MGP_PahariEiJ_G0031581
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgaggctctgcgtgcaggcgctgctgctgctctggctctccttgactgcagta
tgtggagtgccactgatgttgcctccagatggaacagggctagaagaaggcagtatgcgc
tacctggtgaagcccagaacttcgaggactggaccaggagcctggcagggaggcaggagg
aaatttcgcagacagcgcccccgtctctcccataagggacccatgcctttctaa

DBGET integrated database retrieval system