KEGG   Mus pahari (shrew mouse): 110315169Help
Entry
110315169         CDS       T05929                                 

Definition
(RefSeq) mast cell protease 2-like
  KO
K01329  chymase [EC:3.4.21.39]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    110315169
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mpah01002]
    110315169
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     110315169
Peptidases [BR:mpah01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110315169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 110315169
NCBI-ProteinID: XP_021044957
Position
Unknown
AA seq 199 aa AA seqDB search
MQALLFLVVLLLPSGAGAEEIIGGVEAKPHSRPYMAHLKFINEKGSMERCGGFLIDPQFV
MTAAHCRGREITVTLGAHNINKKESTQQTIKTEKQIVHPRFQKDSGVNDIMLLKLQKKAE
LTPAVNVIPLPGPSDILKPGKMCWAAGWGQTGVNKPPSDTLREAELRIMDKEACKVHKDY
DDHLQLCVGSPSTSKSIYK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctctactattcctggtggtacttctcttgccttctggtgctggagctgaggag
attattggtggtgttgaggctaaaccacactcccgcccatacatggcccatttgaagttc
atcaatgagaaaggttcgatggagaggtgtggtgggtttctcatagacccccaatttgtg
atgactgctgcacactgtagaggaagagaaatcacggtcacccttggcgctcataacata
aacaagaaagaatccacacagcagacaataaaaactgaaaaacaaatcgttcacccaagg
ttccaaaaggattcgggtgtcaatgacatcatgttactgaagctacaaaagaaagctgag
ttgactcctgctgtgaatgtaattcccctgcctggtccctctgacattctcaagcctggg
aagatgtgctgggcagctggatgggggcaaactggagtgaataaacctccatcagatacc
ctgagagaggctgaactgagaatcatggataaagaggcctgtaaagtacataaggattac
gatgatcatctccaactctgcgtgggcagtccttcaacatcaaaatctatatacaaa

DBGET integrated database retrieval system