KEGG   Mus pahari (shrew mouse): 110315594Help
Entry
110315594         CDS       T05929                                 

Definition
(RefSeq) cytochrome P450 2B19
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00590  Arachidonic acid metabolism
mpah00830  Retinol metabolism
mpah05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110315594
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110315594
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    110315594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 110315594
NCBI-ProteinID: XP_021045265
Position
Unknown
AA seq 169 aa AA seqDB search
VFELFSAVLKYFPGVHRQISKNLQEILDYIGHSVEQHKATLDPSAPRDFIDTYLLRMEKE
KSNHHTEFHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSH
RLPTLDDRTKMPYTDAVIHEIQRFTDLAXIGLPHRVTKDTLFRGYLLPK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagctcttctctgccgtcctgaagtactttcctggtgtccacagacaaatctcc
aaaaaccttcaggaaatccttgactacattggccatagcgtggagcagcacaaggccacc
ttggaccccagtgctccacgagacttcattgatacctaccttttgcgcatggagaaggag
aagtccaaccaccatacagagttccatcaccagaacctcgtgatctctgtgctctctctc
ttctttgctggcaccgagaccaccagcacaacgctccgttacagcttcctgatcatgctc
aagtacccccatgttgcagagaaagtccaaaaggagattgatcaggtgatcggctcacac
cggctaccaactcttgatgatcgaaccaaaatgccatacactgatgcagttatccacgaa
attcagagatttacagatctcgcccngattggtctaccacacagagtcaccaaagacaca
ctgttccgaggatacctgctccccaag

DBGET integrated database retrieval system