KEGG   Mus pahari (shrew mouse): 110316487Help
Entry
110316487         CDS       T05929                                 

Gene name
Gucy2c
Definition
(RefSeq) heat-stable enterotoxin receptor isoform X1
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00230  Purine metabolism
mpah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110316487 (Gucy2c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110316487 (Gucy2c)
Enzymes [BR:mpah01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     110316487 (Gucy2c)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   110316487 (Gucy2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor LapA_dom Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 110316487
NCBI-ProteinID: XP_021046494
Ensembl: MGP_PahariEiJ_G0022760
Position
2
AA seq 1072 aa AA seqDB search
MTSLLGLAVQFLLFQPALMFWASQVRQNCRNGSYEISVLMMDNSAYKEPMQNLREAVEEG
LDIVRERLREAELNVTVNATFIYSDGLIHKSGDCRSSTCEGLDLLREITRDRKMGCVLMG
PSCTYSTFQMYLDTELNYPMISAGSFGLSCDYKETLTRILPPARKLMYFLVDFWKVNNAS
FKPFSWNSSYVYKNGSEPEDCFWYLNALEAGVSYFSEVLSFKDVLRRSEQFQEILTGHNR
KSNVVVMCGTPESFYNVKGDLQVAEDTVVILVDLFSNHYFEDNATAPEYMDNVLVLTLPS
EQSISNASVAGRVSAGRSDFSLAYLEGTLLFGHMLQTFLENGESVTGPKFARAFRNLTFQ
GLAGPVTLDDSGDIDNIMSLLYVSLDTRKYEVLMKYDTHKNKTIPVAKDPNFIWKNHKLP
NDVPGLGPQILMIAVFTLTGILIVLLLIALLVLRKYRRDHALRQKKWSHIPPENIFPLET
NETNHISLKIDDDRRRDTIQRVRQCKYDKKKVILKELKHSDGNFSEKQKIDLNKLLQSDY
YNLTKFYGTVKLDTRIFGVVEYCERGSLREVLNDTISYPDGTFMDWEFKISVLNDIAKGM
SYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQDTISQKG
DVYSFGIIAQEIIVRKETFYTLSCRDQNEKIFRVENSYGTKPFRPDLFLETADEKELEVY
LLVKSCWEEDPEKRPDFKKIESTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEE
RTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYST
PMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRNGNRHAVDISKMALDIL
SFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLR
IHMSSSTIAILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKDQEYNLPTPPTVENQQR
LQAEFSDMIVSALQKRQASGKKSRRPTRVASYKKGFLEYMQLNNSDHDSTYF
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcactgctgggcttggctgtgcagtttctgctcttccagcctgcgctgatgttc
tgggcctctcaggtgaggcagaactgccgcaatggcagctacgagatcagtgtcctgatg
atggataactcagcctacaaagaacctatgcaaaacctgagggaggctgtggaggaagga
ctggacatagtgcgagagcgcctgcgtgaagccgagctaaatgtgactgtaaatgcgact
ttcatctactccgacggtctgattcataagtcaggtgactgccggagcagcacctgtgaa
ggccttgacctactcagggaaattacaagagatcgtaaaatgggctgtgtcctcatgggg
ccctcgtgcacgtattccaccttccagatgtaccttgacacagagctgaactatcccatg
atttccgctggaagttttggattgtcctgtgactataaggaaactctaaccaggatcctg
cctccagccaggaagctgatgtacttcttggttgatttctggaaagtcaacaatgcatcc
ttcaaacccttttcctggaactcttcctatgtctacaagaatggatcggagcctgaagat
tgtttctggtacctcaatgctctggaggccggggtgtcctatttttctgaggtgctcagc
tttaaggatgtactgaggcgcagtgaacagttccaggaaatcttaacaggccataacagg
aagagcaatgtggttgttatgtgtggcaccccagaaagcttctataatgtgaaaggcgac
ctccaagtggctgaagacactgttgtcattctggtagatctgttcagtaaccattacttt
gaggataacgccacagctcctgagtatatggacaacgtcctcgtcctgacactgccttct
gagcagtccatctcaaacgcctctgtcgccgggagggtttcagcgggaagaagtgacttt
tctctcgcttacttggaaggaaccttgctgtttggacacatgctgcagacgtttcttgaa
aatggagaatctgtcaccggtcccaagtttgctcgcgcattcaggaatctcacttttcaa
ggccttgcaggacccgtgactctggatgacagtggggacattgacaacattatgtctctt
ctgtatgtgtctctggataccaggaaatacgaggttcttatgaagtacgacacccacaaa
aacaaaacgattccggtggctaaggaccccaacttcatctggaagaaccacaagctcccc
aatgatgttcctgggctgggccctcaaatcctgatgattgccgtcttcacgctcacgggg
atcctgatagtcctgctgctgatcgccctcctcgtgctgagaaaatacagaagagaccat
gcacttcgacagaagaaatggtcccacattcctcctgaaaatatctttcctctggagacc
aacgagaccaaccacatcagcctgaagattgatgatgacaggagacgagacacaatccag
agagtgcgacagtgcaaatatgacaagaagaaagtgattctgaaagagctcaagcacagt
gacgggaacttcagtgagaagcagaagatagacctgaacaagttgctacagtctgactat
tacaacctgaccaagttctacggcaccgtgaagctggacaccaggatctttggggtggtt
gagtactgcgagaggggatccctccgggaagtgttaaatgacacgatttcctaccctgat
ggcacgttcatggattgggagtttaagatctctgtcttaaatgacatcgctaaggggatg
tcctacctgcactccagtaagattgaagtccacgggcgtctgaaatccaccaactgcgtg
gtggacagccgcatggtagtgaagatcaccgattttgggtgcaattccatcctgcctcca
aagaaagacctgtggacggcccccgagcacctgcgccaggacaccatctctcagaaaggg
gacgtgtacagcttcggcatcattgcccaggagatcatcgtccgcaaggagactttctac
acgctgagctgccgggatcagaacgagaagatcttcagagtggaaaattcctacgggacg
aaacctttccgcccagacctcttcctggaaactgcggatgagaaggagctggaggtctat
ctacttgttaaaagctgttgggaggaggatccagaaaagaggccagatttcaagaaaatc
gagagcacactagccaagatatttggccttttccatgaccagaaaaatgagtcttacatg
gacaccttgatccgacgtctccagctgtattctcgaaacctggaacatctggtggaggaa
aggactcagctgtacaaggcggagagggacagggctgaccaccttaacttcatgctcctc
ccacggctggtggtaaagtcgctgaaggagaaaggcatcgtggagccagagctgtatgaa
gaagtcacaatctacttcagtgacattgtgggcttcaccaccatctgcaagtacagcacg
cccatggaggtggtggacatgctcaatgacatctacaagagctttgaccagattgtggac
caccatgacgtctacaaggtagaaaccatcggcgatgcctacgtggtagccagcggtctg
cctatgagaaacggcaaccggcatgcggtagacatttccaagatggccttggacatcctc
agcttcatagggacctttgagctggagcatctccctggcctccccgtgtggatccgcatt
ggagttcattctggcccctgcgcggctggtgttgtggggatcaagatgcctcgctactgc
ctgtttggggatactgtcaacactgcctccaggatggaatctaccggcctccccttgagg
attcacatgagcagctccaccatagccatcctgaagagaacggattgccagttcctgtat
gaagtaagaggagaaacgtacttaaagggaagagggacggagaccacatactggctgact
gggatgaaggaccaagagtacaacctgccaacgccaccgacagtggagaaccaacaacgt
ctgcaagctgagttctcagacatgatcgtgagcgccttacagaaaagacaggcctcgggc
aagaagagccggagacccactcgggtggccagctacaagaaaggctttttggaatatatg
cagctgaacaattcagaccatgatagcacctatttttag

DBGET integrated database retrieval system