KEGG   Mus pahari (shrew mouse): 110317835Help
Entry
110317835         CDS       T05929                                 

Gene name
Pla2g4b
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00564  Glycerophospholipid metabolism
mpah00565  Ether lipid metabolism
mpah00590  Arachidonic acid metabolism
mpah00591  Linoleic acid metabolism
mpah00592  alpha-Linolenic acid metabolism
mpah01100  Metabolic pathways
mpah04010  MAPK signaling pathway
mpah04014  Ras signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04217  Necroptosis
mpah04270  Vascular smooth muscle contraction
mpah04370  VEGF signaling pathway
mpah04611  Platelet activation
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04724  Glutamatergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04912  GnRH signaling pathway
mpah04913  Ovarian steroidogenesis
mpah04921  Oxytocin signaling pathway
mpah05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110317835 (Pla2g4b)
   00565 Ether lipid metabolism
    110317835 (Pla2g4b)
   00590 Arachidonic acid metabolism
    110317835 (Pla2g4b)
   00591 Linoleic acid metabolism
    110317835 (Pla2g4b)
   00592 alpha-Linolenic acid metabolism
    110317835 (Pla2g4b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110317835 (Pla2g4b)
   04010 MAPK signaling pathway
    110317835 (Pla2g4b)
   04370 VEGF signaling pathway
    110317835 (Pla2g4b)
   04072 Phospholipase D signaling pathway
    110317835 (Pla2g4b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110317835 (Pla2g4b)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110317835 (Pla2g4b)
   04664 Fc epsilon RI signaling pathway
    110317835 (Pla2g4b)
   04666 Fc gamma R-mediated phagocytosis
    110317835 (Pla2g4b)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110317835 (Pla2g4b)
   04913 Ovarian steroidogenesis
    110317835 (Pla2g4b)
   04921 Oxytocin signaling pathway
    110317835 (Pla2g4b)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110317835 (Pla2g4b)
  09156 Nervous system
   04724 Glutamatergic synapse
    110317835 (Pla2g4b)
   04726 Serotonergic synapse
    110317835 (Pla2g4b)
   04730 Long-term depression
    110317835 (Pla2g4b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110317835 (Pla2g4b)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110317835 (Pla2g4b)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110317835 (Pla2g4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 110317835
NCBI-ProteinID: XP_021048312
Ensembl: MGP_PahariEiJ_G0025601
Position
3
AA seq 791 aa AA seqDB search
MALQTCPVYMQAKVPETCLLTVRVLQASGLPSKDLVTSSDCYVTLNLPTASSHTLQTRTV
KNTRNPVWNQNFHFRIHRQLKNVMELKVFDQDLVTKDDPVLSVLFDVGTLQIGTQRQSFS
LGTQEEGRLEVEFRLQTLTDCEEHLISNGILAARELSCLHVELKRTADPKRSERKVQLVV
AGACEGPQDASVGTGSFHFHYPACWEQELNVHLQDDPHEQLKVPLRTLPSSQLVRLVFPT
SQEPLMRLELKKDKGPKELAVRLGCGPCPEEQAFLSRRKQVVAAALKKALQLDQDLQEDE
IPVIAVMATGGGIRAMTSLYGQLAGLQELGLLDCISYITGASGSTWALANLYEDPEWSQK
DLARPTELLKTQVTKSKLGALAPSQLWRYRQELAERARLGYPTCFTNLWALINEALLHDE
PHEHKLSDQREALSRGQNPLPIYCALNSKEQGLSTFDFSEWCEFSPYEVGFPKYGAFIPS
ELFGSEFFMGRLVKQLPESRICFLEGIWSNLFAASLQDSLYWSSEPSQFWDRWAQDQANL
DKEQVPHLKIAEPPTMAGRIAELFTDLLTKRPLAHATHNFMRSLHFHKDYFRHPHFSAWK
ASKLDRLPNQLTPAEPHLCLLDVGYFINTSCPPLLQPTRDVDLILSLDYNLYGAFQQLQL
LSRFCQEQGIPFPSISPSPEEQRQPQECHLFCDPAQPEAPAVLHFPLVNDSFQDYSAPGV
PRTSEEKAAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNICNNQDRLREAMHQAVQ
RRRKRKQLRPE
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcaaacctgcccagtctacatgcaggcaaaggtgccagagacatgcctgctc
actgtacgcgtcctccaggccagtggcttgccatccaaggacctagtaacctcctctgac
tgctatgtgactctgaacctgcccacggcttccagccacacgcttcagacacgcacagtc
aagaacacccgaaaccctgtgtggaatcagaacttccacttccggatccataggcagctc
aagaatgttatggaactgaaagtctttgaccaggacctggtgaccaaagatgacccagtg
ttgtcagtgctgtttgatgtggggactctgcaaattgggactcagcgccagagcttctcc
ttgggtactcaggaggaagggcgcttggaagttgagtttcggctacagactctgacagac
tgtgaggaacacctcatcagcaatggcatcctggcggcccgggaactctcctgcttgcac
gttgaactgaagaggacagcagacccaaagaggtcggagcgcaaagttcaacttgtggtt
gctggggcctgtgagggcccacaggatgcctctgtgggcactggatctttccacttccat
tatccagcctgctgggagcaagagctgaatgttcatctgcaggatgacccccatgagcag
ctgaaggtgccactacgaactctaccctcctcacagctggtgagacttgtcttccccacg
tcccaggagccactgatgaggctggaactcaagaaggacaaaggaccaaaggagctggct
gtgcggctgggctgtgggccctgtcctgaggagcaggccttcctaagcagaaggaagcag
gtggtggctgccgcactgaaaaaggccttacagctggaccaagacctgcaggaggacgag
atcccggtaattgccgtgatggccactggtggtgggatccgggcgatgacgtctctgtac
gggcagctggccggcctgcaggaactcggccttctcgactgcatctcctatatcacgggg
gcttcaggatccacctgggcgctggccaacctctatgaggacccagagtggtcgcaaaag
gacctggcgaggcccactgagctgctgaagacccaggtgacaaagagcaagctgggtgcc
ctggcccccagccagctttggcggtaccggcaagagctggccgagcgtgctcgcctgggc
tacccgacctgcttcaccaacttgtgggccctcattaatgaggccttgctgcatgacgag
ccccatgaacacaaactctcagatcaacgagaggccctaagtcgaggccagaaccctctg
cccatctactgtgccctcaacagcaaggagcagggcctgagtacctttgacttttcggag
tggtgcgagttctctccatatgaggtcggcttccccaagtatggagccttcatcccctcc
gagctctttggctctgagttcttcatggggcggctggtgaagcagcttcccgagtcccgc
atctgcttcctggaaggcatctggagcaatctgtttgcagccagcctccaagacagcttg
tactggtcctcagaacccagccagttttgggaccgctgggcccaggatcaggccaacctg
gacaaagagcaggtcccccatctgaagatagcagaaccaccaacaatggctggcaggatc
gccgagctcttcactgacctcctgacaaagcgtccccttgcccacgccacccacaacttc
atgcgcagcctccatttccacaaggactatttccgccaccctcacttctctgcctggaaa
gcttccaaactggacaggctccccaaccagctgacacctgctgagccccacctctgcctc
ctggatgttggctatttcatcaatactagctgcccacccctcctgcagccaacacgagat
gtggacctcatcttgtcactggactacaacctctacggagcctttcagcagctgcagctt
ctaagccggttctgccaggagcagggcatccctttcccatccatctcacccagccccgag
gagcagcgccagcctcaggagtgccatctgttctgtgacccagcccagcccgaagcccca
gctgtgctgcacttccctttggtcaatgactccttccaagactactctgcccctggggtg
ccacggacatcggaggagaaggcagctggggaggtcaatctgtcttcttccgactcccca
taccactacacaaaagtgacctacagtcaggaagatgtggacaagctgttacatctgacg
cattacaacatctgcaacaaccaggatcggctgcgggaggccatgcaccaggccgtgcag
cggcggagaaagcgcaaacagttgaggcccgagtga

DBGET integrated database retrieval system