KEGG   Mus pahari (shrew mouse): 110318188
Entry
110318188         CDS       T05929                                 

Gene name
Npepl1
Definition
(RefSeq) probable aminopeptidase NPEPL1
  KO
K09611  probable aminopeptidase NPEPL1 [EC:3.4.11.-]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110318188 (Npepl1)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110318188 (Npepl1)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   110318188 (Npepl1)
SSDB
Motif
Pfam: Peptidase_M17 Pdase_M17_N2
Other DBs
NCBI-GeneID: 110318188
NCBI-ProteinID: XP_021048679
Ensembl: MGP_PahariEiJ_G0026197
Position
3
AA seq 524 aa
MASVGLQFQASAGDADPQSRPLLLLGQLQHLHRVPWSHVRGKLQPRVTEELWQAALATLN
PNPTDSCPLYLNCATVAALPSRVSRHNSPSAAHFITRLVRTCLPPGTHRCILMVCEQTEV
FASACALARAFPLFTHRSGASRRAEKRTVMVEFFLVGQDNGPVEVSTLQCLTNAAEGVRL
AARIVDTPCNEMNTDIFLEEIIQVGKELGITPTIIRDEQLKTKGFGGIYGVGKAALHPPA
LAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQ
GFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDL
GADIIVDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFS
EFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGV
ALLLALFGRASEDPLLNLVSPLDCEVDAQEGDNMGRDSKRRRLV
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcgagcgtggggctgcagttccaggccagcgccggggacgcggacccccagagccgg
cccctgctgctgttgggccagctgcaacacctgcaccgcgtgccctggagccacgtccgc
gggaagctgcagccccgggtcaccgaggagctctggcaggcagctctggccacgctcaac
cccaaccccacagacagctgtcccctctacctgaactgcgccacagtggcagctctgcct
tctagggtgagccggcataacagcccgtccgcagcccacttcatcaccaggctcgtgaga
acctgcctgcctcctggaacccaccggtgtatcctgatggtctgcgaacagactgaggtt
ttcgcctctgcctgtgccctggcacgggccttcccactcttcacacaccgttcaggggca
tcccggcgcgcagaaaagaggacagtcatggtggagttcttcttggtgggacaagacaat
ggcccagtggaagtgtccaccttgcaatgtttaaccaatgccgcagaaggtgtccgacta
gcagctcgcattgtggacacgccatgcaatgagatgaacacagacatcttccttgaggag
attatccaagttggaaaggagctgggtatcacccccaccatcatccgcgatgaacagcta
aagaccaaaggattcggaggaatctacggggttggcaaagctgccctccacccacccgct
ctggctgtcctcagccacacccctgatggggccacacagaccattgcctgggtgggcaag
ggcatcgtctatgacaccggcggtctcagcatcaaagggaagaccactatgccagggatg
aaacgagactgtgggggtgctgcagccgtcctgggagccttcagagctgccatcaagcag
ggtttcaaagataacctccatgctgtgttctgcttggccgagaatgcggtcggacccaat
gccaccaggccagatgacattcacctgctgtattcaggaaagaccgtagagatcaacaac
acggatgcagagggcaggctggtgctggcagacggggtgtcttatgcttgcaaagacctg
ggggctgacatcatcgtggacatggccaccctgacaggggcacaaggcattgccacaggg
aagtaccatgcagccgtgctcaccaacagcgccgagtgggaggcagcctgcgtgaaggct
ggccggaagtgcggtgacctggtccacccgctggtctactgtcctgagctgcacttcagc
gagttcacctcggctgtggctgacatgaagaactccgtggcggaccgagacaacagcccc
agctcctgcgctggcctcttcattgcctcccacatcggatttgactggccgggggtgtgg
gtccacctggacattgctgccccagtgcatgctggcgagcgagccacaggctttggggtg
gctctcctactggctctttttggccgtgcctcggaggacccgctgctgaacctggtatcc
ccgctggactgtgaagtggatgcccaggaaggcgacaacatggggcgtgactccaagaga
cggaggctcgtgtga

DBGET integrated database retrieval system