KEGG   Mus pahari (shrew mouse): 110319807
Entry
110319807         CDS       T05929                                 

Gene name
Mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah05200  Pathways in cancer
mpah05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110319807 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319807 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110319807 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110319807 (Mecom)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    110319807 (Mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_11 zf-C2H2_8 zf-met Zn-ribbon_8 PyrI_C
Other DBs
NCBI-GeneID: 110319807
NCBI-ProteinID: XP_021051054
Ensembl: MGP_PahariEiJ_G0026344
Position
4
AA seq 1232 aa
MRSKGRARKLATSNECAYGNYPEIPLEEMPDADADGITNAPSLLIQEPCSPATSSESFTP
KEGSPYKAPIYIPDDIPIPDEFELRESTMPGAGLGIWTKRKIEVGEKFGPYMGEQRSDLK
DSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVAD
IAPGEELLLFMKSEEDPHEPMAPDIHEDRQHRCEDCDQLFESKAELADHQKFPCSTPHSA
FSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPK
AFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFA
TSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTS
SLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGTNRHPAG
LTFPTAPGFSFSFPGLFPSGLYHRPPLIPTSPPVKGLSSTEQSNNCQSPLLAHPQILPAT
QDILKALSKHPPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSG
SDLESDLESDKEKCKENGKMFKDKVSPLQNLASITNKKEYNNHSVFSASVEEQSAVSGAV
NDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSL
PLKMEPQSPSEVKKLQKGGSESPFDLTTKRKDEKPLTSGPSKPSGTPATSQDQPLDLSMG
SRSRAGGTKLTEPRKNHVFGEKKGNNMETRPSSDGSLQHARPTPFFMDPIYRVEKRKLTD
PLEALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFSFRAPPN
TLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESAGAILDDK
EDAYFTEIRNFIGNSNHGSQSPRNMEERMNGSHFKDEKALATSQNSDLLDDEEVEDEVLL
DEEDEDNDIPGKPRKELGMTSLDEEIPEDDYEEAGALEMSCKASPVRYKEEDYKSGLSAL
DHIRHFTDSLKMREMEENQYTDAELSSISSSHVPEELKQPLHRKSKSQAYAMMLSLSDKD
SLHPTSHGSSNMWHSMARAAAESSAIQSISHV
NT seq 3699 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgcctatggtaac
taccctgaaatacctttggaagagatgccagatgctgatgcagatgggataaccaatgct
ccctccctcctcatccaagagccatgctctcctgcgacatccagtgagtcatttactcct
aaggagggctcgccatacaaagcccccatctacatccctgatgacatccccattcctgat
gagtttgagcttcgagagtcaactatgcctggagcaggacttggaatatggaccaaaagg
aagattgaagtaggcgaaaagtttgggccatacatgggagagcagagatcagacctgaaa
gattccagctatggatgggagatcttagatgagttttgcaatgtgaagttctgcatagat
gccagtcaaccagatgtaggaagctggctcaagtacatcagattcgctggctgctatgat
cagcacaaccttgttgcatgccagataaatgatcagatattctaccgagtagtcgcagac
attgcgcctggggaagagctcttgctgttcatgaagagtgaagaggacccgcacgaaccc
atggcgcctgacatccacgaagaccggcagcaccgctgtgaggactgtgaccagctcttt
gaatccaaggcagagctagccgatcaccagaagttcccatgcagcacgccccactcggcc
ttctccatggtggaggaggacttgcaacaaaacctggagagtgagagcgatctccgagag
atccatggcaaccaggactgtaaggaatgtgaccgagttttccccgatctgcaaagcttg
gagaagcacatgctgtcacatactgaggagagggaatacaagtgtgatcagtgtcccaag
gcatttaactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcac
tatgagtgtgaaaactgtgccaaggttttcacggaccctagcaaccttcagcgacacatt
cgatctcagcatgtcggtgcccgggcacatgcttgccctgagtgtggtaaaacatttgcc
acttcgtcaggcctcaaacagcacaagcacatccacagcagtgtgaagccctttatctgt
gaggtctgccataaatcctatactcagttttcaaacctttgtcgtcataagcgcatgcat
gctgattgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtct
tccttaaataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattt
tttggccaaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaat
atgagtcatgccaacccgggcctggctgactattttggcaccaataggcatcctgctggt
cttacctttccaacagctcctggattttcctttagctttcctggtctgtttccttcgggc
ttataccacaggcctcctttgatacccactagtcctcctgttaaaggactatcaagtacc
gaacagtccaacaattgtcaaagtcccctcttggcacatcctcagatactgccagccaca
caggatattttgaaggcactatctaaacacccacctgtaggggacaataagccagtggaa
ctgctgcccgagaggtcctctgaagagaggccccttgagaaaatcagtgaccagtcagag
agtagtgaccttgatgatgtcagtacaccgagtggcagtgacctggaaacaacctcgggc
tctgatctggaaagtgaccttgaaagtgataaagagaaatgtaaagaaaatggtaaaatg
ttcaaagacaaagtaagccctctgcagaatctggcttcgataactaataagaaagaatac
aacaatcattccgttttctcagcatctgtagaggagcaaagtgccgtgtcaggagctgtg
aatgattctataaaggctattgcgtctattgctgaaaaatactttggttccacaggactg
gtggggctgcaagacaaaaaagtcggagcgttaccttacccttccatgtttcccctcccg
ttttttccagcattctctcaatcaatgtacccatttcctgatagagacttgaggtcgtta
cctttgaaaatggagccccaatcaccaagtgaagttaagaaactgcagaagggaggctcc
gagtccccttttgacctcaccactaagagaaaggatgagaagcccttgacttcaggcccc
tcgaagccttcaggaacaccagccacaagccaagaccagcccctggacctaagtatgggc
agtaggagcagagccggtgggacaaagttgactgagcctcgaaaaaaccatgtatttggg
gaaaagaaaggaaacaacatggaaacaaggccatcttcagatggctccttgcagcatgcc
agacccactcccttcttcatggaccccatttatagagtagagaaaagaaagttaactgac
ccgcttgaagctttgaaagaaaaatacttgagaccttctccaggattcttgtttcaccca
caaatgtcagcgattgagaacatggcagaaaagctagaaagctttagcgccctgaaacct
gaggccagtgaactcctgcagtctgtgccctccatgttcagcttcagagctcctcccaac
accctgccagagaacctgctgcggaaggggaaagagcgctacacctgcaggtactgtggc
aagatttttccaaggtctgcgaacctaacacggcacttgagaacccacacaggagagcaa
ccttacagatgcaaatactgtgatagatcattcagcatttcctccaacctgcagcgacat
gtgcgcaacatccacaacaaggagaagccatttaagtgtcacttatgtgacagatgtttt
ggtcaacaaaccaaccttgacagacacctgaagaaacatgagaatgggaacatgtctggt
accgcaacatcctcgccccattcagagctagaaagcgcaggcgcgatcctggatgacaaa
gaagatgcttactttacggagatacgcaatttcatcgggaacagtaaccatggtagccag
tctcctcggaacatggaagagaggatgaatggcagtcacttcaaggatgaaaaggctttg
gcaaccagccaaaattcagatttattggatgatgaagaagtagaagatgaagtgttgttg
gatgaggaggatgaagacaatgatattcccggaaaacccagaaaggagctggggatgact
agtttagatgaggagatcccggaggatgactatgaagaagctggggccctggagatgagt
tgtaaggcgtccccagtgaggtataaagaggaagactataaatctggcctttctgctcta
gatcatataaggcacttcacagatagcctcaaaatgagggaaatggaagagaatcaatac
actgacgctgagctgtcctccattagttcttctcatgtgccagaggagcttaaacagccg
ttacacagaaagtccaaatcacaggcatatgctatgatgttgtcactgtccgacaaggat
tccctccatcccacctcccacggttcctccaacatgtggcacagcatggcaagggctgca
gcagaatccagtgccatccagtccataagccatgtatga

DBGET integrated database retrieval system