KEGG   Mus pahari (shrew mouse): 110319861
Entry
110319861         CDS       T05929                                 

Gene name
Enpep
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    110319861 (Enpep)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110319861 (Enpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110319861 (Enpep)
   04090 CD molecules [BR:mpah04090]
    110319861 (Enpep)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     110319861 (Enpep)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110319861 (Enpep)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110319861 (Enpep)
CD molecules [BR:mpah04090]
 Proteins
  110319861 (Enpep)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Aminopep DUF1570 DUF2613
Other DBs
NCBI-GeneID: 110319861
NCBI-ProteinID: XP_021051177
Ensembl: MGP_PahariEiJ_G0027069
Position
4
AA seq 945 aa
MNFAEGEPSKKYCIKGKHVAIICGVVVAVGLIVGLSVGLTRSCEQDTTPAPSHPPPDTST
VLPPQDQNVCPDSEDESGEWKNFRLPDFIKPVHYDLEVKALMEEDRYTGIVTISVNLSKP
TRDLWLHIRETKITKLPELRRPSGEQVPIRRCFEYKKQEYVVIQAAEDLAATSGDSVYRL
TMEFEGWLNGSLVGFYKTTYVEDGEIRSIAATDHEPTDARKSFPCFDEPNKKATYNISII
HPKEYSALSNMPDEKSEMLDDNWKKTTFKKSVPMSTYLVCFAVHRFIPIKRTSRSGKPLT
VYVQPNQKETAEYAANITKAVFDYFEDYFAMEYALPKLDKIAIPDFGTGAMENWGLVTYR
ETNLLYDPLLSASSNQQRVASVVAHELVHQWFGNTVTMDWWDDLWLNEGFASFFEFLGVN
HAEKDWQMLSQVLVEDVFPVQEDDSLMSSHPVVVTVSTPAEITSVFDGISYSKGASILRM
LQDWITPEKFQKGCQIYLKKFQFANAKTSDFWESLEEASNLPVKEVMDSWTSQMGYPVVT
VSGRQNIIQKRFLLDSKADPSQPPSELGYTWNIPVRWAENDNSRITVYNRSEKAGITLNA
NVSGDVFLKINPDHIGFYRVNYEGGTWDWIAEALSSNHTRFSAADRSSFIDDAFALARAQ
LLNYKIALNLTKYLKSEEDFLPWERVVSSVSYIISMFEDDRELYPMIETYFQGQVKPIAD
LLGWQDTGSHITKLLRASVLGFACKMGDPEALGNASRLFEAWLKGSASIPVNLRLLVYRY
GMQNSGNEAAWNYTLEQYQKTSLAQEKEKLLYGLASVKDVKLLARYLEMLKDPNIIKTQD
VFTVIRYISYNSYGKTMAWNWIQLNWDYLVSRFTLNDRYLGRIVTIAEPFNTELQLWQIQ
SFFAKYPNAGAGAKPREQVLETVKNNIEWLNVNRQSIREWFASGP
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgaactttgcagagggagagccctccaagaaatactgcattaaaggcaaacacgtggcc
atcatctgtggagtagtggtggcagttggattaatagtgggactttctgtgggtttgacc
aggtcgtgtgagcaggacacaaccccagctccttcccaccctcctcccgacaccagcact
gtcctgcctccccaggaccagaatgtctgccctgacagtgaagatgaaagcggagaatgg
aagaacttcaggctgccagacttcatcaaaccagttcactacgacctggaggtgaaggcc
ctgatggaagaagacaggtacacgggcatagtgaccatctctgtcaacttgagcaaaccc
acgcgtgacttatggctccacatcagggagaccaagatcaccaagctgccggagctaagg
aggccctctggggagcaggtaccaattcgacggtgcttcgagtacaagaagcaggagtat
gtagtgatccaggctgcagaagaccttgcggccaccagtggggacagtgtctatcggctg
accatggagtttgaaggctggctgaacggttcccttgtgggtttttacaaaaccacctac
gtggaggacggggaaatcaggagcatagctgccactgaccatgaaccaacagatgccagg
aagtccttcccttgttttgacgaacccaacaagaaggcaacttataatatatccatcatt
cacccaaaagaatactcagcactttcaaatatgccagatgagaaatcagagatgctggac
gacaactggaagaaaaccactttcaagaagtctgtcccgatgagcacttacttggtgtgc
ttcgctgttcatcggttcattcctataaagagaacatccaggagcggcaaaccacttact
gtttatgtgcagcccaatcagaaggagacggcagagtatgcggcgaacataaccaaagct
gtatttgattactttgaagactactttgctatggagtatgcgcttcccaaactggataaa
attgctattccagattttggcaccggcgccatggaaaattggggacttgtcacttaccga
gaaacaaacctgctttatgaccccttgctatcggcctcatccaaccagcagagagtggcc
agcgtggttgcccacgaacttgtacaccagtggtttggaaataccgtgaccatggactgg
tgggacgacttgtggctaaatgaaggatttgcttccttcttcgagttcttgggagtaaac
cacgcagaaaaagactggcagatgctcagtcaggtgctggttgaagatgtcttccctgtg
caagaggacgactccctgatgtcttcacatccagtggtcgtcaccgtgtctacaccagct
gaaataacgtctgtgtttgatggaatatcatacagcaagggagcttctattctgagaatg
ctccaagactggataacaccagagaaattccaaaaagggtgtcagatttacttgaaaaaa
ttccagttcgcgaatgcaaaaacttcagatttttgggaatctctggaagaggcaagcaat
ctaccagtgaaagaagtgatggacagctggactagccagatgggctatcctgtggtcact
gtgagtggaaggcagaacatcatccagaaacgctttctgttggactccaaagccgatcct
tcgcagccaccatcagaactcggttacacatggaatattccagtcagatgggccgaaaac
gacaactcaaggatcaccgtctacaataggtcagaaaaagcaggaatcactttgaatgct
aatgttagtggagatgtttttctcaaaatcaacccagatcacattgggttttatcgtgta
aattatgaaggaggaacttgggactggatagctgaggctctctcctcaaaccacacgaga
ttctccgcggctgaccggtcaagttttattgatgatgctttcgctttggcaagagctcaa
cttctgaattataaaatagctttgaacttgaccaagtatctcaaatcagaagaagatttc
ctaccatgggagagagtcgtttcatctgtaagctacatcattagcatgttcgaagatgac
agagagctgtaccccatgatagagacatactttcaaggtcaagtgaagcccattgcggat
ttgctgggatggcaggataccggaagccacatcacaaagttactccgggcctctgtatta
ggattcgcatgtaagatgggagacccagaagccttgggcaacgcttcccggttatttgag
gcctggttgaaagggagtgcaagtattccggtgaacctcaggctgctcgtgtaccgctat
ggaatgcagaactctggcaacgaggcagcgtggaactataccctagagcagtatcagaaa
acatcgcttgcccaagagaaggaaaaactgctctatgggttagcttcagtgaaggatgtt
aaactcttggcaaggtatctggaaatgctcaaagaccccaatattattaaaactcaggat
gtatttactgtcatccgctacatctcgtacaacagctatgggaagaccatggcttggaat
tggatacaactcaactgggactatctagtcagcagatttacactcaatgacagatacctt
ggtcgcatcgtcaccatagctgaacccttcaacactgagctgcagctctggcagatacag
agcttttttgcaaaatatccaaatgctggtgctggagcaaaacctagagagcaagtgctg
gaaacagtgaagaacaatatcgagtggctaaatgtgaacaggcagtccatcagagagtgg
tttgctagcgggccgtag

DBGET integrated database retrieval system