KEGG   Mus pahari (shrew mouse): 110320350Help
Entry
110320350         CDS       T05929                                 

Gene name
Si
Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00052  Galactose metabolism
mpah00500  Starch and sucrose metabolism
mpah01100  Metabolic pathways
mpah04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110320350 (Si)
   00500 Starch and sucrose metabolism
    110320350 (Si)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110320350 (Si)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110320350 (Si)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     110320350 (Si)
    3.2.1.48  sucrose alpha-glucosidase
     110320350 (Si)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110320350 (Si)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110320350
NCBI-ProteinID: XP_021051963
Ensembl: MGP_PahariEiJ_G0026515
Position
4
AA seq 1818 aa AA seqDB search
MAKKKFSGLEISLIVLFIIVTIIAIALVVVLATKVPAVEEITSPTSAPSPGKCPPEQGEP
INERINCIPEQHPTKAKCEERGCCWRPWNNTAIPWCFFADNHGYNAESVTNENTGLKATL
NRIPSPTLFGEDIKSVLLTTQSQTRNRFRFKITDPNNKRFEVPHQFVKDGNGIPAADTLY
DVQVSENPFSIKVLRKSNNKVLFDTSIGPLVYSNQYLQISTRLPSAYIYGFGEHIHKRFR
HDLYWKTWPIFTRDEIPGDNNHNLYGHQTFFMGIEDNSGKSYGVFLMNSNAMEVFIQPTP
IITYRVTGGILDFYIFLGDTPEQVVQQYQELIGRPAMPAYWNLGFQLSRWNYKSLDKVKE
VVRRNREAGIPYDAQVTDIDYMEDKKDFTYDEVAFKGLPEFAQDLHNHGQKYIIILDPAI
SINKRANGTEYQTYVRGNEQNVWVKESDGTTSLIGEVWPGLTVYPDFTNPRTWEWWANEC
NLFHQQVEYDGLWIDMNEVSSFIQGSLKGCALDLLNYPPFTPGILDKIMYSKTLCMDAVQ
HWGKQYDVHSLYGYSMAIATEKAVEKVFPNKRSFILTRSTFAGSGRHASHWLGDNTASWE
QMEWSITGMLEFGMFGMPLVGADICGFLANTTEELCRRWMQLGAFYPFSRNHNADGYAEQ
DPAVFGPNSLLVNTSRHYLTIRYTLLPFLYTLFYRAHAFGETVARPFLHEFYEDPNSWIE
DTQFLWGSALLITPVLRPGVSYVSAYIPDATWYDYETGEKRPWRKQRIDMYLPEDKIGLH
LRGGYIIPIQQPDVTTTASRKNPLGLIVALDDNQAAKGDFFWDDGETKDTIEKEIYILYE
FSVSNNNLVVNCTHSSYPEGNALMFKTIKVLGLRDTVTAVTVGENDQQMSPHLAFTFDAF
NKILSITDLNFNLSKTFIVRWTTQPFSDNEKFTCYPDVGTATEKTCVERGCLWEPVSALS
NVPACYFPSNHNPYLLTSTQKLATGITAELQLNPANARIKLPSNPISTLRVEVKYHKNDM
LQFKIYDAHQKRYEVPVPLNIPDTPTSSDENRLYDVEIKEYPFGIQVRRRSSGKLIWDSC
LPGFAFNDQFIQISTRLPSQYLYGFGEVEHTAFKRNLNWHTWGMFTRDQPPGYKLNSYGF
HPYYMALEDEGNAHGVLLLNSNGMDVTFQPTPALTYRTIGGILDFYMFLGPTPEVATKQY
HEVIGFPVMPPYWALGFQLCRYGYRNTSEIEQLYDEMKAAQIPYDVQYTDINYMERQLDF
TIGERFKTLPQFVEKIRREGMKYIIILDPAISGNETQPYPAFERGIQKDVFVKWPNTNDI
CWAKVWPDLPNITIDETITEDEAVNASRAHVAFPDFFRNSTSEWWAREIYDFYNEKMKFD
GLWIDMNEPSSFVNGTVTNKCRNDILNYPPYFPELTKRNEGLHFRTMCMETEHILSDGSS
VLHYDVHNLYGWSQVKPTLDALRNTTGLRGIVISRSTYPTAGRWGGHWLGDNYANWDNLE
KSLIGMLEFNLFGMPYVGADICGFFNNSEYHLCARWMQVGAFYPYSRNHNIQFTRRQDPV
SWNETFAQMSKKVLEIRYTLLPYFYTQMHEAHIHGGTVIRPLMHEFFDDKETWEIYRQFL
WGPAFMVTPVVDPYQTSVNGYVPNARWFDYHTGEDIKVRGKRQTFSAPFDTINLHVRGGY
ILPCQEPAQNTHYSRLNYMKLIVAADDNQIARGTLFWDDGESIDTHEKNLYTLIQFNLNQ
TTLTSTVLNDGYRNKNEMRLGNIYVWGKGTTRISEVNLIYGGNKQRLAFTQDEAKEILTI
DLKNVNVTLDQPIQISWS
NT seq 5457 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaaattcagtggattagaaatctctctgattgtcctcttcatcatagta
acaataatagccatcgctcttgttgtggttttggcaacaaaggtgccggctgtggaagaa
ataacaagtccaacttcagcccctagtccaggaaagtgtccgcctgaacaaggtgaacct
attaatgagagaataaactgcattccagaacaacatccaacaaaggcaaaatgtgaagag
cgtggctgttgctggcgtccatggaacaacactgccattccttggtgcttctttgcagat
aaccatggttataatgctgagtcagtcacgaatgaaaatactggacttaaagccacactg
aacagaatcccttctcccactctatttggagaagacattaaaagcgtcctcctcacaact
cagagtcagacccgtaatcgtttccggttcaagatcacagatccaaataacaagagattt
gaagtgccacatcagtttgtaaaagatggaaatggaatcccagcagctgacacactgtat
gatgtccaggtctcagaaaacccgttcagcatcaaagtcctcaggaaaagcaacaacaaa
gtcttgtttgataccagtattggtcctctggtgtactcaaaccaatatttgcagatttca
acaagactgccaagtgcatatatttatggctttggggaacatattcacaagcgatttcgt
catgacttatactggaaaacatggccaatctttactcgagatgagattcctggtgataat
aatcataatctctatgggcatcagacattcttcatgggcattgaagataactctggcaag
tcctatggtgtttttcttatgaacagcaatgcaatggaggttttcatccagccaacacca
ataattacttacagagttactggtggcatattagacttttatatattccttggagacaca
ccagaacaagttgttcaacaataccaggagctcattggacgaccagcaatgccagcatat
tggaaccttggctttcaactgagtcgctggaattacaagtctttagataaagtgaaagaa
gtagtaagaagaaaccgggaagctggcatcccatatgatgcacaagtcactgatattgac
tacatggaagacaaaaaggactttacttatgatgaagtggcatttaaaggacttcctgaa
tttgctcaggatttacataaccatggacaaaaatatatcatcatcctggaccctgcaatc
tctataaataagcgtgcaaatggtaccgaatatcaaacatatgtgagggggaatgagcaa
aatgtttgggtgaaagagtcagatggaaccacatcacttataggagaggtatggccagga
ttaacagtatacccagattttactaatcccagaacctgggagtggtgggcaaatgaatgc
aatcttttccatcagcaagtggaatatgatggactctggattgacatgaatgaagtttcc
agctttattcaaggttctctgaaaggatgtgctctcgatttactgaattaccctcctttt
actcccggtattcttgacaaaatcatgtattccaaaactctttgcatggatgctgtgcag
cactgggggaaacagtatgatgtacacagcctgtatggatacagcatggctatagccaca
gagaaagctgtggaaaaagtttttcctaataagagaagcttcatccttacccggtcaaca
tttgctggttcaggacgccatgcttctcattggctcggagacaacacagcctcctgggag
cagatggaatggtccatcactggaatgctggagttcggcatgtttggcatgcctttggta
ggggcggacatctgtggatttttggctaacaccacagaagaactctgcagaagatggatg
caactgggagccttttatccattttctagaaaccacaatgctgatggctatgcagaacag
gatcctgctgtttttggacccaactctcttttggtgaacacatcgaggcactacctaacc
atccgctatactttgcttcccttcctctacactctgttctatagagcccacgcatttggt
gagacagttgcaagaccatttcttcatgagttttatgaagacccaaacagctggattgag
gacacccagttcctatggggctctgcactgcttatcactcctgttttgagaccaggagta
agctacgtgagcgcatatattcctgatgctacctggtatgattatgaaacaggtgaaaaa
aggccatggagaaaacaaaggattgacatgtaccttccagaagataaaataggattacat
cttagaggaggttatattatccctattcagcaacctgatgtaacaacaacagcaagccga
aagaatcctctaggccttattgttgcattagatgataaccaggcagcaaaaggagacttc
ttctgggatgatggtgaaactaaagataccatagaaaaggagatctatatattatacgag
ttttcagtttctaataataacttggttgttaactgcacacattcatcatatccagaagga
aatgcccttatgtttaagacaatcaaagtccttgggctgagagacactgttacagctgtt
acagtgggtgaaaatgaccagcaaatgagtcctcatcttgctttcacttttgatgctttc
aacaagattctctcaattacagatctcaacttcaacctcagcaaaacctttatagttaga
tggacgacgcaacctttctcagacaatgagaaattcacttgttacccagatgtaggcaca
gctactgagaaaacctgtgtagagagaggctgcttatgggaaccggttagtgcgctctct
aatgtgcctgcatgctactttccttcgaaccacaatccctatttgttaacttcaactcaa
aaattggcaacgggaataacagcagaacttcagttgaatcctgcaaatgctagaattaag
cttccatctaatcccatctccactctacgtgtggaagtaaaatatcacaaaaatgacatg
ctacagtttaagatttatgatgcacatcaaaagagatatgaagttcctgtaccactgaat
attccagacacccctacaagctctgatgaaaatagactctatgatgtagaaatcaaggaa
tatccttttggcatccaggttcgaaggagaagcagtggaaagcttatctgggattcttgc
ctacctggatttgccttcaatgatcaattcattcagatatctacacgtctgccatcacaa
tatttatatggttttggggaagtagaacacacagcattcaagcgaaatttgaattggcac
acttgggggatgttcacaagagatcaacctcctggatataaacttaattcctatggattc
catccctattacatggctttggaggatgagggcaatgctcatggagttctgttactgaac
agcaatggaatggatgttacattccagccaacgcctgctctaacctaccgcacaattggt
ggcatcttggatttttacatgtttttgggaccaaccccagaagttgcaacaaagcaatat
catgaagtaattggctttccagtcatgccaccttactgggctctaggattccaattatgt
cgttatggatacagaaatacttcagagattgagcaactgtatgatgaaatgaaagctgct
caaatcccctatgatgttcagtatacagacatcaattatatggaaaggcaactagacttc
acaattggggagcgattcaagactcttcctcagtttgttgaaaaaataagaagagaggga
atgaaatatattattatactggatccagcaatttcaggaaatgaaacacagccttatcct
gccttcgaaagaggaatacagaaagatgtttttgtcaaatggcctaacacaaatgacatt
tgctgggcaaaggtttggccagatttacctaatattacaatagatgagactataacagaa
gatgaagctgttaatgcttccagagcacacgtagcctttccagacttctttaggaattcc
acatcagagtggtgggcaagagaaatttatgatttctacaatgaaaaaatgaagtttgat
ggcttgtggattgacatgaatgaaccttccagctttgtaaatggaacagttacaaataaa
tgcagaaatgatatactaaattatccaccttattttccagaactcacaaaaagaaatgag
gggttacattttcgaactatgtgcatggaaacggaacatatccttagtgatggatcatca
gttttgcattatgatgtgcacaatttatatggatggtcacaagttaaacccactctggat
gcattaaggaacaccactggtcttcgagggatagtcatttctcggtccacttatcccaca
gctggtcgatgggggggacactggttgggagacaactatgcaaactgggataatttggaa
aaatcactcattggtatgctggaatttaatctttttgggatgccatatgttggagcagat
atctgtggtttctttaacaactcagaatatcacctctgtgctcggtggatgcaagttgga
gccttttatccatattcaagaaatcacaacattcaatttactagaaggcaagatcctgtt
tcctggaatgaaacttttgctcaaatgtcaaagaaagttttagagatcagatacacgttg
ctgccctatttctacacacagatgcatgaagcccacattcatggtggaactgtcatcaga
cccctaatgcatgagttctttgatgataaggaaacctgggaaatatacaggcagttccta
tggggtccagcttttatggtgactcctgtcgttgatccttaccagaccagtgtgaatggc
tatgttcctaatgctcgatggtttgactaccatacaggggaagacataaaggtcagagga
aaacgtcaaacattttcagctccttttgatacaataaatctacatgtccggggaggttat
attctcccatgtcaagaaccggcacagaacacacattacagtcgactgaattacatgaag
cttatagtagctgcagatgacaaccaaatagcaagaggaactctgttctgggatgatgga
gagtccatagacacacatgaaaaaaatctatataccttaatacaattcaatttaaatcag
acaactttaacaagtactgtattgaatgatgggtatagaaacaaaaatgagatgagactt
ggaaatatctatgtatggggaaaaggaacaacccgtatcagtgaggttaatctgatttat
ggtggaaataaacagcgacttgcatttactcaagatgaagctaaggagatactaacaatt
gacctgaaaaatgtaaatgttactcttgatcaaccaatacaaatcagctggtcatga

DBGET integrated database retrieval system