KEGG   Mus pahari (shrew mouse): 110320815
Entry
110320815         CDS       T05929                                 

Gene name
Tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00100  Steroid biosynthesis
mpah01100  Metabolic pathways
Module
mpah_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110320815 (Tm7sf2)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110320815 (Tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 110320815
NCBI-ProteinID: XP_021052590
Ensembl: MGP_PahariEiJ_G0014082
Position
1
AA seq 418 aa
MTSREASQAPLEFGGPWGVAAMLILLPATLFHLLLAARSGPARLLALPSYLPGLEELWSP
RALLLLFIWLGLQVALYLLPARKVAEGLELKDKSRLRYPINGFQALVLTALLMGLGVSVG
LPLGALPGMLLPLAFATTLTSFIFSLLLYAKALVAPASALAPGGNSGNSVYDFFLGRELN
PRLGSFDFKYFCELRPGLIGWVFINLALLVQEAELQGSPSLAMWLVNGFQLLYVGDALWY
EESVLTTMDIIHDGFGFMLVFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLLKAIG
YYIFRGANSQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGLSHLLPYFYVLYFTALLVHREARDEQQCLRKYGRAWQEYCRRVPYRIIPYVY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgacttctcgtgaggcctcccaggccccactggaattcggggggccgtggggcgtcgcg
gctatgctgatcctgctgcctgccaccttgttccacctgctcctggcggcccgctcgggc
ccggcgcgcctcctggccctaccgtcttatctgcctggactggaggagctgtggagccca
cgggctctgctgctattgttcatctggctcggcctgcaggtggcgctctatttgctgcct
gcacggaaggtggccgaagggctggaactgaaggacaagagtcgcctgcgctaccctatt
aatggcttccaggctctggtgctaacagccctgttgatggggctgggggtgtcagtgggg
ctgcccctgggggcactccctggaatgctcctgcccttggcctttgcgaccactctcacc
agctttatcttcagcctcctcctctatgcgaaggctttggtagctcctgcctcagccctg
gctcctgggggaaactcaggaaattccgtgtatgacttctttctgggacgggagctgaac
cctcgcctcggttcctttgacttcaaatacttctgtgagctgagacctggcctcatcggc
tgggttttcattaacctggccctgctggtgcaggaggcggagcttcaggggagtccttca
ctggctatgtggctggtcaatggcttccagttgctgtatgtgggtgatgccctctggtat
gaggagtctgtcctcaccaccatggacataatacatgatggctttggcttcatgctggtc
tttggagacctagcctgggtaccattcacctacagcctgcaggcccagttcctgttgtac
catccacagcctctggggctgcccatggccttgctcatctgcctccttaaggctattggt
tactacatcttccgaggggccaactcccagaaaaacacattcagaaagaatccttctgac
cccagtgtggctggtcttgagaccatcccgacggccaccgggaggcagctgctggtgtct
gggtggtggggtatggttcgacaccccaactacctgggagatctcatcatggctctggcc
tggtccttgccctgtgggctatcccatctgctaccctacttctacgtcctctacttcact
gcattgctggtgcaccgcgaggcccgagatgagcagcagtgtctccgaaagtacggccgt
gcctggcaggagtactgcaggcgtgtgccttaccgaatcataccctatgtctactga

DBGET integrated database retrieval system