KEGG   Mus pahari (shrew mouse): 110321199
Entry
110321199         CDS       T05929                                 

Gene name
Rnpep
Definition
(RefSeq) aminopeptidase B isoform X1
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110321199 (Rnpep)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     110321199 (Rnpep)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110321199 (Rnpep)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2 IF3_C
Other DBs
NCBI-GeneID: 110321199
NCBI-ProteinID: XP_021052972
Ensembl: MGP_PahariEiJ_G0027871
Position
5
AA seq 650 aa
MESSGPGSCGRAARRPLHSAQAVDVASASSFRAFEILHLHLDLRVEFGPPGPGPGSRGLS
GRATLELRCLLPEGASELRLDSHSCLEVTAATLRRGQPGDQQAPAEPVPFHTQPFSHYGQ
ALCVAFPQPCGAAERFELDLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFP
CFDTPAVKCTYSALIEVPDGFTAVMSANTWEKRGPNKFFFQMSQPIPSYLIALAIGDLAS
AEVGPRSRVWAEPCLIEAAKEEYSGVIEEFLTTGEKLFGPYVWGRYDLLFMPPSFPFGGM
ENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRIST
ILFGAAYTCLEAATGRALLRQHMDVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCF
VSYLAHLVGDQDQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFD
RWLNTPGWPPYLPDLSPGDSLMKPAEELAELWVTPEPDMQAIEAVAISTWKTYQLVYFLD
KILQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDYQEEFRKVKDFLQSQGK
QKYTLPLYHAMMGGSETARTLAKDTFAATASQLHSNVVNYVQQILAPKDS
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggagagcagcggaccaggcagctgcggcagggcggcccggcggccgctgcactcggct
caagccgtggacgtggcctcggcctccagcttccgcgccttcgagatcctgcacctgcac
ctggacctgcgggtcgagttcgggcctccgggccctggtccggggagccgcggactgagc
ggcagggcgacgctggagctgcgttgtttgcttcccgagggcgcctcggagctgcggctc
gactcgcacagctgcttggaggtgacggcggcgacgctgcggcggggacagccgggagac
cagcaggctcccgcggagcccgtgcctttccacacgcagcccttctcgcactatggccag
gccctgtgcgtggccttcccgcagccctgcggtgccgccgagcgcttcgagctggatctc
acctaccgcgtcggggagggacccggggtttgctggttggctcctgagcagacagcagga
aagaagaaaccctttgtctatacccagggtcaggcggtcttaaaccgagccttttttcct
tgctttgacactccagcagtgaaatgcacgtattcggctcttattgaggttccagatggc
ttcacagctgtgatgagtgcaaacacctgggagaagagaggaccaaataagttcttcttc
cagatgagccagcccatcccctcctatctgatagctttggccattggagatctggcttca
gctgaggttggacccaggagccgggtgtgggcggagccctgcctgattgaagccgccaag
gaggagtacagtggggtcatagaagaatttctgacaacaggagagaagcttttcggaccc
tatgtttggggaaggtatgacttgctctttatgccaccatcctttccatttggaggaatg
gagaatccttgcctgacctttgtcactccgtgcctgctagcaggggaccgctccttagcc
gacgtcatcatccacgagatctcccacagttggtttgggaacctggtcaccaatgccaac
tggggagagttctggctcaatgaaggcttcactatgtatgcccagaggaggatctccacc
atcctgtttggagcagcttacacttgcttggaggctgccacagggagggctctgctgcgc
cagcacatggatgtctccggagaggaaaacccactcaacaagctccgggtgaagattgaa
ccaggtgtggaccccgatgacacctacaacgagaccccctacgagaaaggttactgcttt
gtctcatacctggcccacctggtgggggatcaggatcagtttgacaagtttctcaaggcc
tatgtagatgaatttaaattccaaagtatcttggctgaagattttctggaattctacctg
gagtatttccctgagctgaagaagaagggagtagattccattccaggttttgagtttgat
cggtggctgaacactcctggctggcccccctacctccccgacctctcccctggggactca
ctcatgaagccagccgaagaactggcggagctgtgggtgaccccagagccagacatgcaa
gccattgaagccgtggccatctctacctggaagacctaccagctcgtctacttcctagat
aagatcctgcagaagtctcctctccctcctgggaatgtgaaaaaacttggggagacatac
ccaaagatttccaatgctcagaatgctgagttacggctaagatggggccaaatcatcctt
aagaatgactaccaagaggagttcaggaaagtgaaggacttcctgcagagccagggaaag
cagaagtacactctgcctctgtaccatgccatgatgggtggcagcgagacggcccggacg
ctggccaaggacacctttgccgccactgcttcccagctccacagcaacgttgtcaactat
gtccagcagatcctggcacccaaggacagttag

DBGET integrated database retrieval system