KEGG   Mus pahari (shrew mouse): 110321281Help
Entry
110321281         CDS       T05929                                 

Gene name
Map4k4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110321281 (Map4k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110321281 (Map4k4)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110321281 (Map4k4)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: STE group
  STE20 family
   110321281 (Map4k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 110321281
NCBI-ProteinID: XP_021053139
Ensembl: MGP_PahariEiJ_G0027321
Position
5
AA seq 1319 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
ILQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHAQQQPPLP
QQQDRSKPSFHAPEPKPHYDPADRAREVEDRFRKTNHSSPEAQAKQTGRGLEPPVPSRSE
SFSNGNSESVHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDP
CPPSRSEGLSQSSDSKSEVPEPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGS
GQQNSQAGQRNSTSSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGER
FRVRSSSKSEGSPSPRLESAAKKPDDKKEVFRPLKPAGEVDLTALAKELRAVEDVRPPHK
VTDYSSSSEESGTTDEEEEDVEQEGADDSTSGPEDTRAASSLNLSNGETESVKTMIVHDD
VESEPAMTPSKEGTLIVRQTQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVG
FSCDGLRPEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLL
VGTESGLMLLDRSGQGKVYPLISRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNK
ILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMA
FKSFGELLHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHIQCSIKPH
AIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMGWGEKA
IEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTSLLSW
NT seq 3960 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctcccgcgaagagcctggtggacattgacctgtcgtccctgcgggac
cctgctgggatttttgagctggtggaagtggttggaaatggcacctatggacaagtctat
aagggtcgacatgttaaaacgggtcagctggccgccatcaaggttatggatgtcaccgag
gatgaagaggaagaaatcaaactggagataaatatgctgaagaagtattctcatcatcga
aatattgccacatactatggtgctttcattaagaagagccctccaggacacgatgaccaa
ctctggcttgttatggagttttgtggggccgggtccatcacagaccttgtgaagaacacc
aaagggaacactcttaaagaagactggattgcgtacatctccagggaaatcctcagggga
ttggcacatctccacattcaccatgttattcaccgagatatcaagggccagaatgtgctg
ctgacggagaatgctgaggtgaaacttgttgattttggtgtaagcgctcagctggacagg
acggttggacggagaaatacgttcataggcacaccctactggatggctccagaggtcatt
gcctgcgatgagaacccagacgccacttacgactacagaagtgacctctggtcttgtggc
atcacggccatcgagatggctgaaggggccccccctctctgtgacatgcatccaatgaga
gcactgtttctcatccccagaaaccctcctcccaggctgaagtcaaaaaaatggtcaaag
aaatttttcagctttatagaaggctgcctggtgaagaattacatgcagcggccctctaca
gagcagcttttaaaacaccctttcataagggatcagcccaatgaaaggcaggttcgaatc
cagcttaaggatcacatagaccggaccagaaagaagagaggcgagaaagatgagacggag
tacgagtacagcgggagcgaggaggaggaggaggaagtgcctgagcaggagggagagcca
agttccatcgtcaatgtgcctggagagtcaactctgcgacgtgatttcctgagactgcag
caggagaacaaggagcggtctgaggctctgcggagacagcagcttctgcaggagcaacag
ctccgggaacaggaggagtataagaggcagctgctggctgagaggcagaagcggattgaa
cagcagaaagagcagaggaggcggctggaagagcaacaaagaagagagcgtgaagccagg
aggcagcaggagcgtgagcagcggcggcgtgaacaagaggagaagaggcgccttgaggaa
ctggaaagacggcggaaagaagaggaggagaggagacgggcagaagaagagaagaggaga
gtggagagggaacaggagtacatcaggcggcaactagaggaagagcagcggcacctggag
atcctgcagcagcagctgctccaggagcaggccatgttactggagtgccgatggcgggag
atggaggagcaccggcaggcagagaggctccagagacagttgcaacaagaacaagcatat
ctcctgtctctacagcatgaccacaggaggccgcacgcacagcagcagccgccgctcccg
cagcagcaggacaggagcaaaccgagcttccatgctccagagcccaagcctcactatgac
cctgctgacagagctcgggaggtggaagatagatttagaaagactaaccacagctcccct
gaggcccaggctaagcaaacgggcagaggactggagccacccgtgccttcccggtcagag
tctttttccaatggcaactccgagtctgtgcaccctgccctgcagagaccagcagagcca
caggtacagtggtcccacctggcatctctcaagaacaatgtctcccctgtctcgaggtcc
cattccttcagtgacccttctcccaaattcgcacaccaccatctccgctctcaggaccca
tgtccaccttcccgcagtgaggggctcagtcagagctctgactctaagtcggaggtgccc
gagcccacccaaaaggcttggtctagatcagacagtgacgaggtgcctccaagggttccc
gtgagaacaacctctcgttccccagtcctctcccgtcgggattccccactgcagggcagt
ggacagcaaaatagccaagcaggacagagaaattccaccagtagtattgagccccggctt
ctctgggagagagtggaaaagctggtccccaggccaggcagtggcagctcttcagggtcc
agcaactcaggatcccagcccggctcccatcctgggtctcagagtggttccggtgaacgc
ttcagagtgagatcatcgtccaagtctgaaggttctccatcgccacgcctggaaagtgca
gccaaaaagcctgacgataagaaagaagtattccggcctctcaagcctgcgggagaagtg
gacttgacggcattggccaaagagcttcgagcagtggaagatgtgcggccacctcacaaa
gtaactgactactcatcctccagtgaggagtctgggaccacagatgaggaggaggaggac
gtggagcaggagggggctgatgattctacctcgggaccagaagacaccagagcagcgtca
tctctgaatctgagtaatggtgaaacagaatctgtgaaaacaatgatcgttcatgatgat
gtagaaagtgagccagccatgaccccatccaaggagggcaccctcatcgtccgccagact
cagtccgctagtagcacactccagaaacacaaatcttcctcctcctttacaccttttata
gaccccaggttactacagatttctccatctagtggaacgacagttacttctgtggtggga
ttttcctgtgatgggctgagaccagaagccataaggcaagatcctactcggaaaggctca
gtggtcaatgtgaaccccacgaacactaggccacagagtgatacccccgagattcgtaaa
tacaagaagagatttaactcagagatcctgtgtgctgccttatggggagtgaacttgctg
gttggcacagagagtggtctgatgctcttggacagaagtggccaagggaaagtgtaccct
ctgatcagccgaagacggttccagcaaatggatgtgcttgaaggcctgaatgtcctggtg
acaatctctggcaaaaaggataagttacgtgtctactatttatcctggctaagaaataag
attcttcataatgatccagaggttgagaagaagcaagggtggaccactgtgggcgacttg
gaagggtgcgtgcactataaagtcgtaaaatatgaaagaatcaagtttctggtaattgct
ttgaagagttctgtggaagtctatgcatgggcaccgaagccatatcacaagtttatggcc
tttaagtcatttggagaactgctacataagccattactggtggatctcactgtggaggaa
ggccagaggttgaaagtgatctatggatcctgtgcgggattccatgctgttgatgtggat
tcaggctcagtctatgacatttatctaccaacacacattcagtgtagcatcaaaccccat
gcaatcattatcctccccaacacggatggaatggagctgctggtgtgctatgaagatgag
ggggtttacgttaacacatacggaaggatcaccaaggacgtggttctgcagtggggagag
atgccaacatctgtagcatatatccggtcaaatcagacaatgggctggggagagaaggca
atagagatacgatctgtggaaaccggtcacttggatggtgtatttatgcacaaaagggct
cagagactaaagtttctgtgtgaacgcaatgacaaggtgttctttgcctccgtccgctct
ggtggcagcagccaggtctatttcatgaccttaggcaggacttctcttctgagctggtag

DBGET integrated database retrieval system