KEGG   Mus pahari (shrew mouse): 110321365
Entry
110321365         CDS       T05929                                 

Gene name
Rnpepl1
Definition
(RefSeq) aminopeptidase RNPEPL1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110321365 (Rnpepl1)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110321365 (Rnpepl1)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110321365 (Rnpepl1)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N DUF2268
Other DBs
NCBI-GeneID: 110321365
NCBI-ProteinID: XP_021053245
Ensembl: MGP_PahariEiJ_G0027679
Position
5
AA seq 720 aa
MAAQCCCRKAPGAEAAPARPPPEPPPALDVASASSAQLFRLRHLQLGLELRPEARELAGC
LVLELCALRPAPRALVLDAHPALRLHSVSFRRASAVSESPCTFAFPAPGSGPPLPAFADA
PGAESAGCPLAFRLDPFTDYGSSLTVTLPPEVQAHQPFQVILRYTSTDAPAIWWLDPELT
YGNAKPFVFTQGHSVCNRSFFPCFDTPAVKCTYSAVVKAPLGVQVLMSATRSVYVEEEGL
YHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERL
YGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDVIHEVAHSWFGNAVT
NATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFRLDALHRQMRLLGEDSPVSKLQV
KLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGDPQRFDDFLRAYVEKYKFTSVVAQDLLD
SFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPL
EQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRW
LQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFALEVFYQTQGRLHPNL
RRTIQQILSQGLGPSAEPSAEPSTELGGAEADTNPDSPALLLGDEAPSSTISLRDVNVSA
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcggcgcagtgctgctgccgcaaggcgcccggcgccgaagccgcgcccgcccgcccg
ccgccggagccgccgcccgccctggacgtggcctcggcctccagcgcgcagctcttccgc
ctccgccacctgcagctgggcctggagctgcggcccgaggcgcgtgagctggccggctgc
ctggtgctggaactgtgcgcgctgcggcccgcgccccgcgcgctcgtgctcgacgcgcac
ccggccttgcgcctacactcggtctcgttccgccgcgcctccgccgtctccgagtcgccg
tgcaccttcgccttccctgccccggggtcggggcccccgctgcctgccttcgccgatgcg
cctggagcggagtctgccggctgcccgctggccttcaggctggacccgttcaccgactat
ggctcctctctgaccgtcacactgcctcccgaggtgcaggcgcaccagcccttccaggtc
atcctacgctacacctcgaccgacgcccccgccatctggtggctggacccagagctgacc
tatggcaatgccaagccgttcgtcttcacccagggacactctgtgtgcaaccgctccttc
ttcccgtgcttcgacacgcccgcggtcaagtgcacctactcagccgttgtcaaggccccc
ttaggggtacaggtgctgatgagtgcgacccggagcgtgtacgtggaagaggaaggcctc
taccacttccacatggagcacccagtacccgcctacctcgtagcccttgtggccggagac
ctcaagccagcagacattgggcccaggagccgtgtgtgggccgagccatgcctcctgccc
acagccaccagcaagctatcgggtgcagtggaacagtggctgagtgcagcagagcggtta
tatggaccatacatgtggggcagatatgacatcgtcttcctgccgccctccttccccatc
gtggccatggagaacccctgcctcactttcatcatctcctccatccttgagagtgacgag
ttcctggtgatcgatgtcatccatgaggtagcccacagctggttcggcaatgctgtcacc
aacgctacttgggaggagatgtggctgagtgagggcctggccacctatgcacagcgccgc
atcaccacggagacctatggggctgccttcacctgcctggagacagccttccgcttagat
gccctgcacaggcagatgcggctccttggggaagatagccctgttagcaagctgcaggtc
aagctagaaccaggagtgaatcccagtcacttgatgaacctgttcacctatgagaagggc
tactgtttcgtgtactacctgtcccagctctgtggcgatccccagcgctttgatgacttt
ctccgagcctatgtggagaaatacaaattcaccagtgtggtggcccaggacctgctggac
tccttcctgagcttcttccctgaactgaaggagcagagcgtggactgtcgggcagggctg
gagttcgagcgctggctcaatgccacaggcccaccactggctgagccagacctgtcacag
gggtccagcctaacccggcctgtggaagcccttttccagctgtggactgcagagcccctg
gagcaggcggcagcttcagccagtgccattgacatctccaagtggaggaccttccagaca
gcactcttcctggaccggctgctagacggatccccgttgccccaggaggtggtgatgagc
ctgtccaagtgctactcatccctgctggactccatgaacgctgagatccgcatccgctgg
ctgcagattgtcgtccgaaatgactactaccctgatcttcacagggtccgccgtttcctg
gagagccagatgtcacgcatgtacaccatcccactgtacgaggacctctgcactggtgcc
ctcaagtccttcgctctagaggtcttctaccagacccagggtcggctgcatcccaacttg
cgcagaaccatccagcagatcctgtcccaggggctaggccccagtgccgagccgagtgca
gagcccagcacggaactgggcggtgctgaggcagacacaaacccagactcgccagccctg
ctgctcggggacgaggctcccagcagcaccatctctctcagggacgtcaatgtgtctgcc
tag

DBGET integrated database retrieval system