KEGG   Mus pahari (shrew mouse): 110321602
Entry
110321602         CDS       T05929                                 

Gene name
Aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mpah03021]
    110321602 (Aff3)
Transcription machinery [BR:mpah03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     110321602 (Aff3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 110321602
NCBI-ProteinID: XP_021053599
Ensembl: MGP_PahariEiJ_G0027310
Position
5
AA seq 1250 aa
MDSFDLALLQEWDLESLWGEDILSQRNDSLVLEVQASASRCRSVYEPDRNALRRKERERR
SQETQQDSGGFNSGYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFVAESRAQPQPPSVCSTASSTPTAVPVQQGKRGTMGWQKAGHPP
SDGQQRAAQQGSLRTLLGDGVGRQQTRAKQVCNMEAGLQTQERPPAMAAKHGGSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSTETAVHCAAYRGVPANKPESA
RAKAKLAKFSIPKQAEESRSGESNSCVEEIIREMTWLPPLSAIQAPAKVEPSKFPFPNKD
SQLVSSGHSNPKKADAEPESPDNGASNTSTLEDDLKLSSDDEEGEQQAAQRTALRALADS
SVVQQTNCRGSAPSSKGGSSSSSGGSSSSSDSESTSGSDSETESSSSESESEGSKPPHCS
SPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPERNQYYTPPVKDEGQDCGKLTEI
CQASLRDKELKTTCKEEQRPRTANKAPGSKSVKQKSPPAAVAVTAAALPPAVPSAPTESA
PAPTRRSAGKKPTRRTERTSAGDGANCHRPEEPVAPDTLGASVVGPLEPPKTRPCGNSRT
GHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYVLSKAPT
TTGSEQRLKEAASSSSSSNSTSRASVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPL
KDSDEVRSLWVKIDLTLLSRIPEHLSQEPGVLSAPSAKDTDSAPASHALDTPAEKTLPKS
KRKRKCDNEDDYREVKKAQGRKESAPRLATSTNNTLAGNHCNVNVNSLAIPINKNEKMLR
SPTSPLSDTCKHKYASEDLTSSSRPHSNGLLTSASSNKEPKAESQLQTLAGDLTKASHNS
SENGSLHSKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMREAKRMKHKADAMVE
KFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPE
DKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGSSGKSTGS
PSPMSPNPSPASSVGSQGSLSSSSGLSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWE
MADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRSSVHLS
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtggggtgaa
gatatcctaagccagaggaatgattctctagttctggaagttcaggcgtcagccagcaga
tgcaggagtgtctatgaaccggacaggaatgcgttacggaggaaagagcgagaaagaaga
agtcaagaaacccagcaggacagtggcggctttaactcgggttactcactcttcagcgaa
ccctacaagactaacaagggggatgaactctccaaccggatccagaatacactaggaaat
tatgacgagatgaaagactttttaactgatagatccaaccagagtcatcttgttggcgtc
cccaagccgggtgtccctcagactcccgtgaacaagatcgatgaacattttgtggcagag
tcgagagcccagccccagcccccatcagtctgcagcactgcgtcctccacacctacagct
gtccctgtgcagcagggcaagagaggcaccatgggctggcagaaggctgggcacccacca
tccgatggccaacagagagcagcgcaacagggctctctcaggaccttgcttggagatggt
gttggcagacagcagacaagggccaagcaagtgtgcaatatggaggcggggctacagacc
caggagaggccacctgcaatggcagccaagcacggcggcagtggacactgtgttcagaac
tttcccccatccctggcttcaaaacccagcctggtgcagcagaaaccaactgcctacgtg
aggccgatggatggccaggaccaggctcctgacgaatctcctaagcttaagtcatctaca
gaaactgctgtgcactgcgcagcctacagaggggtcccggccaacaaaccagagtcagcc
cgagccaaggctaagcttgccaagttcagcatccccaagcaagcagaggagagcagatct
ggagaaagcaacagctgtgtggaagaaataattcgggagatgacctggcttcctccactt
tctgccattcaagctcctgccaaagtggaaccaagcaagttcccattcccaaataaggac
tcacaacttgtatcctctggacacagtaatccaaagaaagctgatgcggagccagagagt
ccagacaatggcgcatcgaacacttcaactctggaagacgaccttaagctaagcagtgat
gatgaagagggtgagcagcaggcggcccagagaacagctctccgcgctctagctgacagc
tccgtggttcagcagaccaactgtagaggttcggcgccttccagcaagggcggcagcagc
agcagcagcggcggcagcagctcctccagcgactcagagagcacttccggctccgactcc
gagacggagagcagctccagcgagagcgagagcgagggcagcaagcctccgcactgctcc
agccctgaggccgaacctgcgtcctctaacaagtggcagctggataaatggctaaacaaa
gttaatcctcacaagccgccaattctgatccaaaatgaaagccacggcccggaaaggaat
caatactacacgccgccggtgaaagatgaagggcaagactgcgggaaacttaccgagatc
tgccaagccagcctgagggacaaggagctcaagaccacctgcaaggaggaacagcggccg
aggaccgcaaacaaggcccctggcagcaaaagtgtaaagcaaaagtccccacccgctgcg
gtggctgtgactgcagctgccctcccacccgcggtgcccagcgcacccacggagagcgcg
cctgcgccaacccgcaggtcagcaggcaagaagcccacccggcgcaccgagaggacctca
gccggggacggtgccaactgccaccggcctgaggagccagtggccccagacacgctgggg
gcgagcgtggtgggaccgctagagccccccaaaaccaggccctgcggtaacagcagaaca
ggccaccgcaaggagctgcgctcctccgtgacctgtgagaagcggcgcacgagggggctg
agcagaatcgtccccaaatccaaggagtttattgaaacagaatcttcgtcttcctcttcc
tcctcggactcagacctggagtcggagcaagaggagtatgtcctgtccaaggctccgacc
accactggaagcgagcagcggctgaaggaggccgccagcagcagcagtagcagcaacagc
acctcccgggcttctgtgggctccatcaacgccaggaccaccagtgacattgccaaggag
ctagaggaacagttctacacgctggtcccctttggcaggaatgaactgctatctccgcta
aaggacagcgatgaggttaggtctctctgggtcaaaattgacctgactctcctgtccagg
atcccagaacacctgtcccaggagcctggggtcttgagtgctccttcggccaaggacact
gatagtgccccagccagtcatgcattagacacacctgctgaaaagactttgccaaaatcc
aagaggaaacgcaagtgcgacaatgaagatgactacagggaggtaaagaaggcccaggga
aggaaggagagcgccccacgcctcgccacctccactaataacaccttggctggcaaccac
tgcaacgtgaacgtcaacagcttggcaataccaataaacaaaaatgaaaagatgctccgg
tcacccacttcgccactctcagacacatgtaaacacaaatacgccagcgaggacctgact
tcttccagccgacctcacagcaatgggttgttgacttcagcatcttccaacaaggagcct
aaggctgagagccagctgcagacgcttgctggggacctcacgaaagcgtctcacaacagt
tccgaaaatggctccctccatagcaagtcgaggccccagacggagccgtggtctccaggt
tccaatggccacagggactgcaagagacagaaactaatcttcgatgacatgcctcgaagt
gcagattattttatgcgagaagccaagcggatgaaacataaagcagacgccatggtggag
aagttcgggaaggccctgaactatgccgaagccgccttgtccttcatcgagtgtggaaac
gcaatggaacaagggccaatggaatccaagtctccgtacaccatgtactcggagacagtg
gagctcatcaggtatgctatgagactaaaaacccactcaggccccaatgccacaccagag
gacaaacagttagctgcgctttgttaccgatgcctggctctcctatactggcggatgttt
cgactcaaaagagaccatgctgtaaaatattcaaaagcacttatcgactatttcaagaat
tcatcgaaagctgcccaagccccatccccatgggggtccagtggcaagagcactggaagc
ccatcccccatgtctcccaacccttctcccgccagctccgtggggtctcagggcagcctc
tccagctccagcggcctgtccccatcgaccatcgtcagcatcccccagcgcattcaccag
atggcggccaatcacgtcagcatcaccaacagcatccttcacagctacgactactgggag
atggctgataacctggccaaggaaaacagagagttcttcaatgacctggatttgctcatg
ggacctgtcaccctgcacagcagcatggaacacttggtccagtactcccagcaaggcctg
cattggctgcggagcagcgtacacctgtcctag

DBGET integrated database retrieval system