KEGG   Mus pahari (shrew mouse): 110322363Help
Entry
110322363         CDS       T05929                                 

Gene name
Mgst3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00480  Glutathione metabolism
mpah00980  Metabolism of xenobiotics by cytochrome P450
mpah00982  Drug metabolism - cytochrome P450
mpah00983  Drug metabolism - other enzymes
mpah01100  Metabolic pathways
mpah01524  Platinum drug resistance
mpah05200  Pathways in cancer
mpah05204  Chemical carcinogenesis
mpah05225  Hepatocellular carcinoma
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110322363 (Mgst3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110322363 (Mgst3)
   00982 Drug metabolism - cytochrome P450
    110322363 (Mgst3)
   00983 Drug metabolism - other enzymes
    110322363 (Mgst3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322363 (Mgst3)
   05204 Chemical carcinogenesis
    110322363 (Mgst3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110322363 (Mgst3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110322363 (Mgst3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110322363 (Mgst3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpah02000]
    110322363 (Mgst3)
Enzymes [BR:mpah01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110322363 (Mgst3)
Transporters [BR:mpah02000]
 Other transporters
  Pores ion channels [TC:1]
   110322363 (Mgst3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 110322363
NCBI-ProteinID: XP_021054671
Ensembl: MGP_PahariEiJ_G0028062
Position
5
AA seq 152 aa AA seqDB search
MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGLTWIIGRVLYAYGYYTGDPSKRYRGGVSSL
ALFALMGTTVCSAFQHLGWIRPGLGGGYRSCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggagtatggatttgtgcttctcacgggtgctgccagctttgtg
atggtgctccacctagccatcaacgtgggcaaagcccgcaagaagtacaaggtagagtac
cctgtcatgtacagcacagatcctgagaacgggcatatgttcaactgcattcagcgcgcc
caccagaacacgttggaggtctaccctcccttcctgttcttcctaacggtgggaggtgtt
taccacccgcgcatagcttctggcctgggcctgacctggattattgggcgagtcctttat
gcatatggctactacacaggagaccctagcaagcggtatcgaggaggcgtgagctctctt
gccctctttgccctgatgggcaccaccgtgtgctctgctttccagcatctcggctggatc
agaccaggcttaggcggtgggtacagatcctgccactga

DBGET integrated database retrieval system