KEGG   Mus pahari (shrew mouse): 110322617Help
Entry
110322617         CDS       T05929                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04260  Cardiac muscle contraction
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04911  Insulin secretion
mpah04918  Thyroid hormone synthesis
mpah04919  Thyroid hormone signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04961  Endocrine and other factor-regulated calcium reabsorption
mpah04964  Proximal tubule bicarbonate reclamation
mpah04970  Salivary secretion
mpah04971  Gastric acid secretion
mpah04972  Pancreatic secretion
mpah04973  Carbohydrate digestion and absorption
mpah04974  Protein digestion and absorption
mpah04976  Bile secretion
mpah04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    110322617
   04022 cGMP-PKG signaling pathway
    110322617
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110322617
   04918 Thyroid hormone synthesis
    110322617
   04919 Thyroid hormone signaling pathway
    110322617
   04925 Aldosterone synthesis and secretion
    110322617
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110322617
   04261 Adrenergic signaling in cardiomyocytes
    110322617
  09154 Digestive system
   04970 Salivary secretion
    110322617
   04971 Gastric acid secretion
    110322617
   04972 Pancreatic secretion
    110322617
   04976 Bile secretion
    110322617
   04973 Carbohydrate digestion and absorption
    110322617
   04974 Protein digestion and absorption
    110322617
   04978 Mineral absorption
    110322617
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110322617
   04961 Endocrine and other factor-regulated calcium reabsorption
    110322617
   04964 Proximal tubule bicarbonate reclamation
    110322617
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110322617
Enzymes [BR:mpah01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     110322617
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110322617
  Exosomal proteins of other body fluids (saliva and urine)
   110322617
  Exosomal proteins of colorectal cancer cells
   110322617
  Exosomal proteins of bladder cancer cells
   110322617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Motif
Other DBs
NCBI-GeneID: 110322617
NCBI-ProteinID: XP_021054981
Ensembl: MGP_PahariEiJ_G0028129
Position
5
AA seq 1020 aa AA seqDB search
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAME
DEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtggggcagggcgtgagtactctcctgccgccaccactgcggagaatgggggc
ggcaagaagaaacagaaagagaaggagctcgatgagctgaagaaggaggttgccatggat
gaccacaagctgtccttggatgagctgggccgaaaataccaagtggatctgtctaagggc
ctcaccaaccagcgagctcaggacattctggctagagacggacccaacgccctcactcca
ccccccacaactcctgaatgggtcaagttctgtcgtcagctttttgggggcttctccatc
ctgctgtggattggggcactcctctgcttcctagcctatggtatcctggctgccatggag
gacgaaccatccaacgataatttatatctaggtatcgtgctagcagctgtagttatcgtc
actggctgcttctcctactaccaggaagccaagagctccaagatcatggactccttcaag
aacatggtgcctcagcaagctctggtcatccgagaaggagagaagatgcagatcaatgca
gaggaggtggtggtgggagacctggtggaagtgaagggtggagaccgtgtccctgctgac
ctccggatcatctcttcccacggttgcaaggtggataactcatccctaacaggggagtcg
gagccccagacccgttcccctgagttcacccacgagaaccccttggagacgcgcaatatc
tgcttcttctctaccaactgcgtggaaggcactgccaggggcattgtgattgccacaggt
gaccggacagtgatgggccgcatagccactcttgcctctggcctagaggtgggacagaca
cccatagccatggagattgagcatttcatccagctgatcacaggggtggctgtgttcctg
ggtgtctccttcttcgttctgtccctcatcctgggctacagctggctagaggcagtcatc
ttcctcatcggcatcatcgtagccaacgtgcccgaagggcttttggccaccgtgactgtg
tgcctgacgctgacagccaagcgcatggctcgcaagaactgcctggtgaagaacctggag
gccgtggagacgctgggctccacatccaccatctgctcggacaagacgggcaccctcacc
cagaaccgcatgacagttgctcacatgtggtttgacaaccagatccatgaggctgatacc
acagaagaccagtctggggccacttttgacaaacggtcccccacgtggacagccctgtct
cggattgctggtctctgcaatcgtgctgtcttcaaggccggacaggagaatatctctgta
tctaagcgggacacggctggagacgcctctgagtcagctctgctcaagtgcattgagctg
tcctgtggctcagtgaggaagatgagggacaggaatcctaaggtggcagaaatccccttc
aactccaccaacaaatatcagctctccatccacgagagggaagacagcccccagagccat
gtgctggtgatgaaaggcgccccagagcgcatcctggaccgatgctccaccatcctggta
cagggcaaggagatccctcttgacaaggagatgcaagatgcctttcaaaacgcctacatg
gagctgggaggactcggggaacgagtgctgggcttttgtcagctgaacctgccttctgga
aagtttcctcggggcttcaaatttgacacggatgagctgaactttcccacagagaagctc
tgttttgtggggctcatgtccatgattgatccccccagagcagctgtgccggatgccgtg
ggcaagtgccgaagcgcgggcatcaaggtgatcatggtgaccggggatcaccccatcaca
gctaaggccattgccaaaggtgtgggcattatatcagagggtaacgagactgtggaggac
attgcagccaggctcaacattcctgtgagtcaagtcaatcccagagaagccaaggcgtgt
gtagtgcacggttcagacttgaaggacatgacgtcagagcagctggatgagatcctcagg
gaccacacagagattgtctttgcccggacctctcctcaacagaagctcatcattgtggag
gggtgtcagaggcagggagccattgtggcagtgactggtgacggggtgaatgactccccc
gcgctgaagaaggctgacatcggcattgccatgggcatctccggctccgatgtctctaag
caggcggctgacatgatccttctcgacgacaactttgcctccattgtgacaggcgtggag
gagggccgcctgatctttgacaacttgaagaagtccatcgcgtacaccctaaccagcaac
atccctgagatcactcccttcttgctgttcatcattgccaacatcccccttccgctgggc
actgtgaccatcctctgcatcgacctgggcacagatatggttcctgcaatctcattagca
tatgaagcagctgagagtgacatcatgaagaggcaaccacgaaactcccagacagacaag
ctggtgaacgagaggctcatcagcatggcttacggacagattggcatgatccaggccctg
ggcggcttcttcacctactttgtgatactggcagagaacgggtttctaccgtcgcggctg
ctagggatccgcctggactgggatgataggactaccaatgacctggaggacagctatgga
caagagtggacctacgagcagcggaaggtggtggagttcacatgccacacggccttcttc
gccagcatcgtggttgtgcagtgggctgaccttatcatctgcaagacccgtcgcaactca
gtgttccagcagggcatgaagaacaagatcctgatttttgggctgctagaagagacggct
ttggctgcctttctgtcttactgcccgggcatgggggtcgccctccggatgtacccactc
aaggtcacgtggtggttctgtgcctttccctacagtctcctcatcttcatctatgatgaa
gtacggaagctcatcctacggcgctatcccgggggctgggtggagaaggagacctactac
tga

DBGET integrated database retrieval system