KEGG   Mus pahari (shrew mouse): 110322993Help
Entry
110322993         CDS       T05929                                 

Gene name
Erp44
Definition
(RefSeq) endoplasmic reticulum resident protein 44
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110322993 (Erp44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110322993 (Erp44)
Membrane trafficking [BR:mpah04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    110322993 (Erp44)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110322993 (Erp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin OST3_OST6 Thioredoxin_2 HyaE Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 110322993
NCBI-ProteinID: XP_021055658
Ensembl: MGP_PahariEiJ_G0028337
Position
6
AA seq 406 aa AA seqDB search
MNPAVFLSLADLKYSLLLLVTSIFTPITAEIASLDSENIDEILNSADVALVNFYADWCRF
SQMLHPIFEEASDVIKEEYPDKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMK
REYRGQRSVKALADYIRQQKSNPVHEMQSLDEVTTLDRSKRNIIGYFEQKDSENYRVFER
VASILHDDCAFLSAFGDLSKPERYSGDNVIYKPPGRSAPDMVYLGSMTNFDVTYNWIQDK
CVPLVREITFENGEELTEEGLPFLILFHMKDDTESLEIFQNEVARQLISEKGTINFLHAD
CDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREF
HHGPDPTDTAPGEQDQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgcggtcttcctgtctttagccgacctcaaatactccttgctgctcctggta
acttcaatttttacacctataacagctgaaatagcaagtcttgattcagagaatatagat
gaaattttaaatagcgctgatgttgctttagtaaatttttatgctgactggtgtcgtttc
agccagatgttgcatccaatttttgaggaagcatctgatgtcattaaggaagaatatcca
gataaaaatcaagtagtgtttgccagagttgattgtgatcagcactctgacatagcccag
aggtacaggataagcaaataccctaccctgaaattatttcgtaatggaatgatgatgaag
agagaatacaggggccagcgatcagtgaaagcacttgcagactacatcaggcaacagaaa
agcaacccagtccacgagatgcagagtctagatgaagtcaccactcttgatcgcagtaag
agaaatatcattggatactttgagcagaaggattcagaaaattacagagtttttgaaaga
gtagcaagtattttgcatgatgactgtgccttcctttctgcttttggagatctttcaaaa
ccagaaaggtacagtggagacaatgtaatctacaaaccaccggggcgttctgcgccagac
atggtgtacttgggatctatgacaaattttgatgtaacttacaactggattcaagataaa
tgtgtccctcttgtccgagaaataacatttgaaaatggagaggaattgacagaagaagga
ctgcctttcctcatactcttccacatgaaggatgatacagaaagtttagaaatattccag
aatgaagtagcccggcagttgataagtgaaaaaggtacaataaatttcttacatgcagat
tgtgacaaatttagacatcctctcctccatatccagaaaactccagcagattgccctgtc
atagccattgacagttttaggcatatgtatgtttttggagactttaaggatgtattaatt
cctggaaaactcaagcagtttgtatttgacctacattctggaaaactacacagagaattc
catcacggacctgacccgactgacacagccccaggagagcaagaccaggatgtagcgagc
agccctccagagagctccttccagaagctggcgcccagcgagtataggtatactttattg
agggatcgagatgagctgtaa

DBGET integrated database retrieval system