KEGG   Mus pahari (shrew mouse): 110323321Help
Entry
110323321         CDS       T05929                                 

Gene name
Cpt2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial isoform X1
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00071  Fatty acid degradation
mpah01212  Fatty acid metabolism
mpah03320  PPAR signaling pathway
mpah04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110323321 (Cpt2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110323321 (Cpt2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110323321 (Cpt2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110323321 (Cpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 110323321
NCBI-ProteinID: XP_021056134
Ensembl: MGP_PahariEiJ_G0028591
Position
6
AA seq 658 aa AA seqDB search
MMPRLLLRDWPRCPSLVLGAPSRPLSAVSGPAEYLQHSIVPTMHYQDSLPRLPIPKLEDT
MKRYLSAQKPLLNDSQFRKTELLCKDFEHGIGKELHTYLLAQDKQNKHTSYISGPWFDMY
LTARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNLTVSAVRFLKTLRAGLLEPEVFHLNP
ARSDTDAFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRIPKPSRDELFTDTKA
RHLLVLRKGHFYVFDVLDQDGNIVNPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDVWA
ELRQKLILGGNEETLRKVDSAVFCLCLDDFPMKDLVHLSHTMLHGDGTNRWFDKSFNLIV
AKDGTAAVHFEHAWGDGVAVLRFFNEVFRDSTQTPAIAPQSQPAATDSSVSVQKLSFKLN
GTLKAGITDAKEKFDTTMKTLTIDSIQFQRGGKEFLKKKKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASIFTKRCSEAFVREPNKHSVGELQHMMAECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAARGVTLPELYQDPAYQRINHNILSTSTLSSPAVSLG
GFAPVVPDGFGIAYAVHDDWIGCNVSSYSGRNAREFVHCVQKCLEDMFDALEGKAIKT
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgcgcctgctgttgcgtgactggccccggtgcccctcgcttgtcctgggagcc
cctagtcggcccttaagtgccgtctcggggcccgccgagtatctgcagcacagcatcgta
cccaccatgcactaccaggacagcctgcccaggctgcctatccctaaacttgaagacacc
atgaagagatacctcagtgcacagaagcctctcttgaatgacagccagttcaggaaaaca
gaactgttgtgtaaggattttgagcatggcattgggaaggaactgcatacatacctgctc
gctcaggataaacagaataagcacaccagctacatctcaggcccctggtttgatatgtat
ttaactgctcgagactctgtcgttttaaactttaatccattcatggcattcaatccggac
ccgaagtctgagtataatgaccagctcaccagggccaccaacttgactgtttctgcagtg
cggtttctgaagacacttcgggctggccttctagaaccagaagtgttccacttgaaccct
gccagaagtgacacagatgccttcaaaagactcatccgttttgtcccttcctctctgtct
tggtatggagcctacctggtcaacgcatatcccctggatatgtcccagtattttcggctt
ttcaattcaactcgtatacccaagcccagtcgtgatgaactctttactgataccaaggct
agacacctcctggtcctaagaaaaggacatttctatgtctttgacgtccttgatcaagat
gggaacattgtgaatccctcagaaatccaggcccatctaaagtacattctctcagacagc
agccctgcgcccgagtttcccctggcatatttgaccagtgagaaccgagatgtctgggca
gagctcaggcagaagttgattcttggaggcaatgaggaaaccctgaggaaagtggactct
gctgtcttctgcctctgcctagatgacttcccgatgaaggatcttgttcacctgtcacac
accatgctgcatggtgacggcacgaaccgctggtttgataagtcctttaacctcattgta
gccaaggatggcactgctgcggtccacttcgaacatgcgtggggggatggtgtagcagtc
cttaggtttttcaatgaagtgttcagagacagcactcagacccctgccatcgctccccag
agccagccggccgccaccgactcctctgtgtctgtgcagaaactcagttttaagctcaac
ggcactttaaaggctggcatcaccgatgctaaggagaagtttgataccaccatgaaaacc
ctcaccatcgactccattcagtttcagagaggtggcaaggaattcttgaagaagaagaag
ctgagccccgatgcagtggcccagctggccttccagatggctttcctgcgacagtacggc
cagacagtggctacctatgaatcttgcagcactgcagccttcaaacatggccgcacagag
actatccgcccagcttccatctttactaagagatgctccgaggcatttgtcagggagccc
aacaagcacagtgtgggcgagcttcagcacatgatggctgagtgctccaaataccatggc
cagctgaccaaagaagcagcgatgggccagggctttgaccgacacttgtttgctctacgg
catctggcagcagccagaggggtcaccctgcctgagctctaccaggaccctgcgtaccag
cggatcaaccacaacatcctgtctaccagcactctgagcagcccagcagtgagccttggt
ggctttgcccctgtggtccctgatggctttggcattgcgtatgctgttcacgatgactgg
ataggctgcaatgtctcctcctactcaggacgcaatgcccgagagtttgtccactgtgtc
cagaagtgcttggaagacatgttcgatgccctagaaggcaaagccatcaaaacttag

DBGET integrated database retrieval system