KEGG   Mus pahari (shrew mouse): 110324884
Entry
110324884         CDS       T05929                                 

Gene name
Akap5
Definition
(RefSeq) A-kinase anchor protein 5 isoform X1
  KO
K16522  A-kinase anchor protein 5
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110324884 (Akap5)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     110324884 (Akap5)
SSDB
Motif
Pfam: WSK RL10P_insert
Other DBs
NCBI-GeneID: 110324884
NCBI-ProteinID: XP_021058271
Ensembl: MGP_PahariEiJ_G0029619
Position
7
AA seq 654 aa
MESSVSEIQVETKDEKRPVAASPHKERQERQTATLCFKRRKKANKTKPKAGSRAAEETKK
HTPEAGGSGQRQPAGAWASIKRLVTHRKRSEPAKKQKPSEAEVQPEDGALPKKKAKSRLK
FPCLRFSRGAKRSRHSKLTEDSGYVRVQGEADDLEIKAQTQPDAQAIQARSAQGLQEGVL
VRDGKKSQESHVSNSITTGENVIAIELELENESSTIQMGTPELEKETKVITEKPSVQAQQ
ASLLESSAAGSPQSVTSAAPPSPAATHQHSLEEPSNAIRESAPSGKDDRRKKTAAEEKKS
GETALGQAEEAAVGQADKRALSQAGEATAGHPEEATVIQAESQTKEGKLSQAEETTVAQA
KEAVLSQAKEGELSQAEEPAVGQAKKATVGQAEEAIVGHTEKVTVDQAEQATVGQAEQAT
VGQAEEATVGQAEEATVGQAEEATVGHTKKVTVDQAEEATVGQAEEATVGQAEEATVGQA
EEATAEEATVGQAEEATVGHTEKVTVDQAEEATVGQAEEPTVGQAEEPTVGQAEEVVSSH
APDLKENGIDTEKPRSEESKRMEPIAIIITDTEISEFDVKKSKNVPKQFLISMENEQVGV
FANDSDFEGRTSEQYETLLIETASSLVKNAIELSVEQLVNEMVSEDNQINTLFQ
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggagagcagcgtctctgagattcaggtagagactaaggacgagaagagaccagtagca
gccagtcctcataaagagaggcaggagagacaaacagccacactgtgcttcaagagaagg
aagaaagcgaacaagacaaagcccaaagctggttccagggctgctgaggagacaaagaaa
cataccccagaagctgggggctctggtcagcggcaaccagcaggggcctgggcctccatc
aaacgccttgtgacacacaggaaaaggtccgagcctgcaaagaagcagaagccatctgag
gcagaagtgcagcctgaggatggagctcttcctaagaaaaaggcaaaatccagacttaag
tttccttgcctaagattctcaagaggggcaaagagaagtcgtcattccaaactcacagaa
gattcaggctatgtcagagtccagggagaggcagacgatttggagataaaagcccagacc
cagccagatgcccaggcaatccaggctaggtctgcccagggcctacaggaaggtgtgttg
gtgagagatggtaagaagagccaagaatcacacgtaagcaacagcatcaccacgggagag
aacgtgattgccatagaactggagttagaaaatgaatcctctactatccagatgggaact
ccagagctggaaaaggagacgaaagtgattacggaaaagccaagtgtgcaggcgcagcaa
gcaagtctacttgagagttcagcagcaggcagccctcagtcagtgacttctgctgctcct
ccatcaccagcagccacacatcaacatagtctggaagaacccagtaacgccattcgcgaa
agtgccccaagtgggaaagatgacagaaggaaaaagactgctgctgaagaaaagaaatca
ggagagactgcactgggccaggcagaggaagctgcagtcggccaggcagacaaaagggca
ctaagccaggctggagaagctacagcgggccacccagaggaagctactgtgatccaggca
gagagtcagacaaaggaagggaaactgagccaagcagaggaaactacagtggcccaggca
aaggaagctgtattgagtcaggcaaaggaaggtgaactgagccaggcagaagaacctgca
gttggccaggcaaagaaagctacagttggccaggcagaggaagctatagttggccacacg
gagaaagtcacagtggatcaggcagagcaagccacagtgggtcaggcagagcaagccaca
gtgggtcaggcagaggaagccacagtgggtcaggcagaagaagctacagttggtcaggca
gaggaagctacagttggccacacaaagaaagtcacagtggatcaggcagaggaagccaca
gtgggtcaggcagaggaagccacagtgggtcaggcagaggaagccacagtgggtcaggca
gaggaagccacagcagaggaagccacggtgggtcaggcagaggaagctacagttggccac
acagagaaagtcacagtggatcaggcagaggaagctacagtgggtcaggcagaggaaccc
acagtgggtcaggcagaggaacccacagtgggtcaggcagaggaagttgtatcgagccat
gcaccagatctgaaagaaaatggaattgatacagagaaaccaagatcagaagaaagcaaa
agaatggagccaattgctattatcattactgacactgaaatcagtgaatttgatgttaag
aaatctaaaaatgtccctaagcaattcctaatttcaatggaaaacgagcaagtgggggtt
ttcgctaatgatagtgattttgaggggagaacttcagaacagtatgaaacactcttaata
gaaacagcttcttctctcgtcaagaatgctatcgagttgtctgtagaacagctggttaat
gaaatggtttctgaggataatcaaataaatacgctgttccagtga

DBGET integrated database retrieval system