KEGG   Mus pahari (shrew mouse): 110325569Help
Entry
110325569         CDS       T05929                                 

Definition
(RefSeq) mast cell protease 4
  KO
K01329  chymase [EC:3.4.21.39]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    110325569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mpah01002]
    110325569
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     110325569
Peptidases [BR:mpah01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110325569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 110325569
NCBI-ProteinID: XP_021059289
Ensembl: MGP_PahariEiJ_G0030346
Position
8
AA seq 246 aa AA seqDB search
MQVLLFLMALLLPSGAGAEEIIGGVESRPHSRPYMAHLEITTERGFRATCGGFLITRQFV
MTAAHCKGREITVTLGAHDVSKTESTQQKMKVEKQIVHPKYNFYSNLHDVMLLKLQKKAK
ETPSVDVIPLPRPSDFLKPGKMCRAAGWGQTGVTEPTSDTLREVKLRIMDKEACKDYWLY
NYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWIN
RVIKGK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcctactattcctgatggcacttctcttgccttctggggctggagctgaggag
attattggtggtgttgagtctagaccacactcccgcccttacatggcccatctggagatc
accactgagagagggttcagagccacctgtggtgggtttctcataacccgccaatttgtg
atgactgctgcacactgtaaaggaagagaaatcactgtcacccttggagctcatgatgtg
agcaagactgaatccacacagcagaagatgaaagtagaaaaacaaatcgttcacccaaag
tacaacttctattccaatctccatgacgtcatgttactgaagcttcaaaagaaagccaag
gagacaccctctgtggatgtaattcccctgcctcgtccttctgactttctcaagccaggg
aagatgtgccgggcagctggctggggtcaaactggagtgacagaacctacctcagatacc
ctgagggaggtgaaactgagaatcatggataaagaggcctgtaaagactattggctttac
aactataacctccaggtctgcgtgggcagtcccagaaagaaaagatcagcgtacaaggga
gactctggaggaccactactgtgcgctggggtggcccatggtattgtatcttatggacgt
ggagatgcaaagccccctgcagtcttcacccgaatctccccatatgtgccctggattaac
agagtcataaagggcaagtag

DBGET integrated database retrieval system