KEGG   Mus pahari (shrew mouse): 110326294
Entry
110326294         CDS       T05929                                 

Gene name
Lta4h
Definition
(RefSeq) leukotriene A-4 hydrolase isoform X1
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00590  Arachidonic acid metabolism
mpah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110326294 (Lta4h)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110326294 (Lta4h)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     110326294 (Lta4h)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110326294 (Lta4h)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N DUF4367
Other DBs
NCBI-GeneID: 110326294
NCBI-ProteinID: XP_021060251
Ensembl: MGP_PahariEiJ_G0031354
Position
9
AA seq 611 aa
MPEVADTCSLASPASVCRTKHLHLRCSVDFARRALTGTAALTVQSQEENLRSLTLDTKDL
TIEKVVINGQEVKYTLGESQGYKGSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLT
PEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYRFNQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNRTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNTIKTFGDS
HPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSV
TTDDWKSFLYSHFKDKVDLLNQVDWNAWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAK
EEDLNTFSIADLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNLNAINNSEIRFRWL
RLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVHTYQEHKASMHPVT
AMLVGRDLKVD
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcccgaggtcgcggatacttgctccttggcttctccagcctcggtctgccgaaccaag
cacctccatcttcgctgcagcgtcgacttcgctcgccgggcgctgaccgggacggccgcg
ctcacggtccagtcacaggaggagaatctgcgcagcctgactttggacacaaaagacctc
acaatagaaaaagtggtgatcaatggacaagaagtcaaatacacccttggagaaagtcaa
ggttacaaagggtcgccgatggaaatctctctccccatcgccctgagcaaaaatcaagag
gtcgttatagaaatttcctttgagacgtctcccaagtcctctgctcttcagtggctcact
cctgaacagacgtcagggaagcagcatccgtatctcttcagccagtgccaggccatccac
tgcagggccatcctcccttgccaagacactccttctgtgaaattaacctacaccgcagag
gtgtctgtcccgaaagaactggtggctctcatgagtgccatccgcgatggagaagctcct
gacccagaagaccccagcaggaagatttacagattcaaccagaaggtccccataccatgc
tacctgattgctttggttgttggagctttagaaagcagacaaattggcccaaggactctg
gtgtggtccgagaaagagcaggtggagaaatctgcttatgaattttctgagaccgaatcc
atgcttaaaattgcagaagatctgggaggaccctatgtttgggggcagtacgacctcttg
gttctgcccccgtccttcccgtacggcggcatggagaacccttgtcttacgttcgtgact
cctacgctactggcaggtgacaagtcactctccaacgttattgcacatgaaatatctcat
agctggacaggaaacctagtgactaacaggacgtgggatcacttttggttaaacgaagga
catactgtctacttagagcgccacatttgtggacggttgtttggggaaaagttcagacat
ttccatgcattgggaggatggggagagctacagaatacgataaaaacctttggggactcc
catcccttcaccaagctcgtggttgatctgaaggacgtagaccccgacgtagcctattcc
tccattccctatgagaagggcttcgcattactcttctaccttgaacagcttcttggggga
ccagaggtgtttctaggattcttaaaggcttatgttaagaagttctcataccaaagcgta
accaccgatgactggaagagcttcctatattcccactttaaagataaggtggatcttctc
aatcaagttgattggaacgcctggctctatgctccaggcctgcctcctgtcaagcccaat
tacgacgtgactctgacaaatgcttgcattgccttaagtcaaagatgggtcactgccaaa
gaggaagatttaaacacattcagcatcgcagacctgaaggatctctcgtcccatcagctg
aatgagttcctggcacaggtgcttcagaaggcacctcttcccttggggcacataaagcga
atgcaagaggtgtacaacttgaatgccattaacaattctgaaatacgattcagatggtta
cggctctgcattcaatcgaaatgggaggaagcaattcctttggccctaaagatggcaacc
gaacaaggaaggatgaagtttacacgacctctgttcaaggatctcgctgccttcgacaaa
tcccatgatcaagctgtccacacctaccaagagcacaaagccagtatgcatcctgtgact
gcaatgctggtggggagagatctgaaagtggattaa

DBGET integrated database retrieval system