KEGG   Mus pahari (shrew mouse): 110326499
Entry
110326499         CDS       T05929                                 

Gene name
Trhde
Definition
(RefSeq) thyrotropin-releasing hormone-degrading ectoenzyme
  KO
K01306  pyroglutamyl-peptidase II [EC:3.4.19.6]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110326499 (Trhde)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.6  pyroglutamyl-peptidase II
     110326499 (Trhde)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110326499 (Trhde)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 110326499
NCBI-ProteinID: XP_021060658
Ensembl: MGP_PahariEiJ_G0031279
Position
9
AA seq 1025 aa
MGEDDAALRASGRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSIVALLAVTMLAVL
LSLRFDECGASAAMPGTDGGLGGFPERDSNSSSPGSARRNHHAGGESSQRESGEVGTPGT
PSAEPPSEEEREQWQPWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRY
VVLHASRVTVEKVQVAEDRAFGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNA
LIENELLGFFRSSYVIHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYL
SLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGVVVRLYARPD
AIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRI
LLDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYP
AWNMEKQRFLTDVLHEVMLLDGLASSHPVSQEVLRATDIDRVFDWIAYKKGAALIRMLAN
FMGHSVFQRGLQDYLTIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPV
ITILGNTTAENRIHITQQHFIYDIGSKTKALQLQNSSYLWQIPLTIVVGNRSHVSSEAII
WVSNKSEHHRITYLDKGSWILGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAA
LIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNE
YILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISD
WISSNRNRIALNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRN
LLSRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNS
KLISGVTEFLNTEGELKELKNFMKSYDGVAPASFSRAVETVEANVRWKRLYQDELFQWLG
KAMRH
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgggagaagacgacgccgcgctccgggcaagcggcagggggctctcggacccgtgggct
gactcggtgggagtgagaccccgcaccacggagcgccacatcgcagtgcacaagaggctt
gtgctggcctttgccgtgtccatcgtggcactgctggctgtcaccatgctggccgtcctg
ctcagcctacgattcgacgagtgtggagcgagcgcggcgatgccgggcaccgacggtggc
ctcgggggcttccccgagcgcgacagcaacagcagctccccaggatctgcccggcgcaac
caccacgcgggcggggaatcctctcagcgtgagagcggcgaggtgggcaccccggggacc
ccgtctgccgagccgccgtcggaggaagagcgggagcagtggcagccctggacgcagctg
cgcctatccggccaccttaagccgctgcactacaatttgatgctcactgctttcatggag
aacttcaccttctctggggaggtcaacgtggagatcgcgtgccggaacgccacccgctac
gtggtactgcacgcctcccgggtgacggtggagaaggtgcaagtagcggaagaccgggcg
ttcggggctgtcccggttgcaggctttttcctctacccacaaacgcaggtcttggtggtg
gtgctgaacagaaccctggacgcgcagaggaattataatctgaagattatctacaatgcc
ctgatagagaacgagcttttgggcttcttccgcagctcctacgtgatccacggggagaga
agattcctcggggttactcagttttcacctacacatgccagaaaggcatttccgtgtttc
gatgagccaatctacaaggccactttcaagatcagcatcaaacaccaagcaacctatttg
tcgctgtccaacatgccagtggagacatccgtgtttgaggaagatggatgggtaacagat
cacttttcacagacccctctcatgtccacatattatttagcctgggcgatttgcaacttc
acatacagagaaactaccaccaagagtggggttgtagtccgattatatgcaagacccgac
gctatcagaagaggatccggggactatgctctccatattacaaagagattaatagaattt
tatgaagactactttaaagtgccctattctttgccaaaactagatcttttagctgtgcct
aagcatccttatgctgctatggagaactggggactaagtatttttgtggaacaaagaata
ctgctggatcccagtgtgtcatctatttcttatttgctggatgtcaccatggtcattgtt
catgaaatatgtcaccagtggtttggtgaccttgtgactccagtttggtgggaagatgtg
tggctgaaggaaggctttgctcactactttgaatttgtgggtacagactacctctaccct
gcctggaacatggaaaagcagagatttctgacagatgttctgcatgaggtgatgctgctt
gacggattggccagttcccatccagtatcacaggaagtgctacgggcaacagatattgac
agagtgttcgactggatcgcatacaaaaagggtgccgctctaattagaatgctggctaat
tttatgggccattcagtttttcagaggggattgcaagattatttaaccattcacaagtat
ggcaatgcagccagaaatgatctctggaatacattatcagaggctttaaaaaggaatgga
aaatacgtgaacatacaagaagtaatggatcagtggacactccagatggggtatcctgtt
atcaccatcctgggaaacacgacggcagaaaatagaatacatatcacccaacagcatttc
atttatgacatcggttctaaaactaaagcacttcaacttcaaaacagcagttacctgtgg
cagattccattaaccattgtggtaggaaatagaagccatgtgtcttcagaagcaattatt
tgggtgtctaacaaatcagaacatcacagaataacgtacttagacaaaggaagctggatc
cttggaaacatcaatcaaaccggctactttagagtcaactatgacctaaggaactggaga
ttactgatcgatcagttaatcaggaaccatgaggtactttctgtcagtaaccgtgcggcc
ttgatcgatgatgccttcagcctggccagggcaggctatttgcctcagaatattccccta
gagatcatcagatacctgtctgaggaaaaggattttcttccttggcacgctgccagccga
gctctttatcctctggataaattactggaccgcatggagaactacaacatcttcaatgaa
tatattctaaaacaagttgcaacaacatacatcaagcttggatggccaaaaaataacttc
aatggatctcttgttcaagcctcctaccaacatgaagagctacggagggaagtgataatg
ttggcatgtagctttgggaacaagcactgtcaccagcaggcgtcaacactgatttcagac
tggatttccagcaacagaaacagaattgccctgaatgttagagacatcgtctactgcaca
ggggtgtcgctgctggatgaggatgtctgggagttcatctggatgaaattccactctacc
actgcagtttctgagaaaaagatactgctggaggcgctaacttgcagcgatgacaggaat
ttattaagtaggcttctaaatctgtctctgaattctgaggtggtgttggatcaagatgca
attgatgtaattatccacgtagccagaaatccacatggccgggaccttgcatggaagttt
ttcagagacaaatggaaaatactaaataccaggtatggagaagcactgtttatgaattcc
aaacttatcagtggagttacagaatttcttaatacagaaggcgaacttaaagagctaaag
aacttcatgaagtcctatgatggagtagcacctgcttctttctcacgtgctgtggaaacc
gtggaagccaatgtgcgctggaaaaggctttaccaagatgagcttttccagtggctggga
aaagccatgagacactaa

DBGET integrated database retrieval system