KEGG   Mus pahari (shrew mouse): 110326608Help
Entry
110326608         CDS       T05929                                 

Gene name
Mars
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00450  Selenocompound metabolism
mpah00970  Aminoacyl-tRNA biosynthesis
mpah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110326608 (Mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110326608 (Mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpah01007]
    110326608 (Mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mpah03016]
    110326608 (Mars)
Enzymes [BR:mpah01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110326608 (Mars)
Amino acid related enzymes [BR:mpah01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110326608 (Mars)
Transfer RNA biogenesis [BR:mpah03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110326608 (Mars)
 Prokaryotic type
   Other AARSs
    110326608 (Mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C Anticodon_1 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 110326608
NCBI-ProteinID: XP_021060826
Ensembl: MGP_PahariEiJ_G0031194
Position
9
AA seq 910 aa AA seqDB search
MRLFVSEGSPGSLPVLAAAARARGRAELLISTVGPEECVVPFLNRPKVPVLQLDSGNYLF
SPSAICRYFFLLCGWEQDDLTNQWLEWEATELQPVLSAALHCLVVQGKKGEDVLGPLRRV
LTHMDHSLSRQNCPFLAGDTESLADIVLWGALYPLLQDPAYLPEELGALQSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPQPPPPEGRAVSNEPEEEELATLSEEDIVTAVA
AWEKGLESLPPLRLQQHPVLPVPGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYC
RLRQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHAIHADIYRWFSISFDTFGRTT
TPQQTKITQDIFQRLLTRGFVLQDTVEQLRCERCARFLADRFVEGVCPFCGYEEARGDQC
DKCGKLINAIELKKPQCKICRSCPVVKSSRHLFLDLPKLEKRLEDWLGKTVPGSDWTPNA
RFIIRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYVSITANYTDQWEK
WWKNPEQVDLYQFMAKDNVPFHGLVFPCSALGAEDNYTLVKHIIATEYLNYEDGKFSKSR
GIGVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLIKNNSELLNNLGNFINRAG
MFVSKFFGGCVPEMALTPDDRRLVAHISWELQRYHQLLEKVRIRDALRSILTISRHGNQY
IQVNEPWKRIKGGEMDRQRAGTVTGMAVNMAALLSVMLQPYMPTVSSTIQTQLQLPPAAC
RILATSFVCTLPAGHRIGTVSPLFQKLENDQIENLRQRFGGGQLEESLELKAKGSPKPAA
VEAVTTAGSQHIQRLVDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLALAEGKP
IETPKGKKKK
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgagattgttcgtgagcgagggttccccggggagcctgcccgtgctggctgcggccgcg
agggcccggggtcgggcggagctgctcatcagcaccgtaggccccgaagagtgtgtggta
ccattccttaaccggcctaaggtccctgtcttgcagctggatagtggcaactacctcttc
tctcctagtgccatctgccgatatttttttctgttatgtggctgggaacaagatgatctc
accaaccagtggctggaatgggaggcaacagaactgcagccagttctgtctgctgcccta
cactgtctagtggttcaaggcaagaaaggggaagatgtacttggcccacttcgcagagtc
ctgactcacatggatcacagcttgagtcgtcaaaactgtcctttcctggccggggacaca
gaatctctagctgacattgttttgtggggagcgctatatcctttactgcaagacccagct
taccttcctgaggagttgggtgccctacaaagctggttccagacgctgagtacccaggaa
ccatgtcagcgagctgcagagacggtgctaaaacagcagggtgtcctggcacttcgtccc
tacctccaaaaacagccacagccacagcccccacctcctgaggggagagctgtcagcaat
gagcctgaggaagaggagctggctaccttgtctgaggaggacatcgttacagctgttgct
gcgtgggagaagggtctggaaagcttgcctccgctacggctccagcagcatccagtgttg
cctgtgcctggagaaaggaatgttctcatcaccagcgccctcccttatgtcaacaatgtc
ccccaccttggaaacatcattggctgtgttctcagtgctgatgtctttgcaaggtattgt
cgccttcggcagtggaataccctctatctgtgtggcacagatgagtatgggactgcgaca
gagaccaaggcaatggaggagggcctaaccccacaggagatctgtgacaagtaccatgcc
atccacgctgacatctaccgctggttcagcatatcgttcgatacttttggtcgcaccacc
actcctcagcagaccaaaatcacccaggacatcttccagaggttgctgacacggggtttt
gtgctgcaagatactgtagagcagcttcggtgtgagcggtgtgcacgtttcctggctgac
cgctttgtggagggagtgtgtcccttctgtggctatgaagaagcccgaggtgaccagtgt
gacaagtgcggcaagctcatcaacgccattgagctcaagaaaccgcagtgcaaaatctgc
cgctcctgcccagtggtgaagtcttcacggcacctgtttctagacttgcctaagttggaa
aagcgcctggaggactggttggggaagacagtgcctggcagtgactggacacccaatgcc
aggttcattatacgttcctggcttcgagatggcctcaagccacgatgcatcaccagagac
ctcaaatggggaactcctgtgcccttggaaggttttgaggacaaggtattttacgtctgg
tttgatgctactattggctacgtgtccatcacagccaactacactgaccaatgggagaaa
tggtggaagaacccagaacaggtggacctttatcagttcatggccaaagacaatgttccc
ttccatggcttggtctttccgtgttcagccctaggagctgaggacaactacaccctggtc
aagcacatcattgctacagaatacctcaactatgaggatgggaaattctctaagagccgg
ggcataggagtgtttggagacatggcccaggatacagggatccctgctgacatctggcga
ttctacctgctatacattcggcctgagggccaggacagtgccttctcctggactgacttg
ttgattaaaaacaattctgagctgctcaacaacctgggcaacttcatcaacagggctggc
atgtttgtgtctaagttttttggcggctgtgtgcctgagatggcactaacccctgatgac
agacgcctggtggcccacatctcctgggaactccagcgctatcaccagctgttggaaaag
gttcggatccgggatgccttgcgcagtatccttaccatatctcgccatggcaaccagtac
attcaagtgaatgagccctggaaacggattaaaggcggtgagatggacaggcagcgggca
ggcacagtgacaggcatggcagtgaacatggctgccttgctgtctgtcatgctgcagccg
tacatgcccacagtcagctccaccatccagacccagctccaactcccgcctgcagcctgc
cgcatccttgctacaagctttgtttgtaccttgccagcaggccaccgaattggcacagtc
agtcctttgttccaaaaattggaaaatgaccagattgaaaatttgaggcagcgctttgga
gggggccagctagaagagtccttggagttaaaggctaaaggctcccccaagccagcagct
gtagaggcagttacaacagcagggtcgcagcacatacaaaggctggtggatgaggtaacc
aaacagggcaacatagtccgcgaactgaaagcacagaaggcggacaagaaccaggttgct
gcagaggtggctaagctcttggatctaaagaaacagttggctttggctgaggggaaaccc
atcgaaactcctaaaggcaagaagaaaaagtga

DBGET integrated database retrieval system