KEGG   Mus pahari (shrew mouse): 110327089
Entry
110327089         CDS       T05929                                 

Gene name
Rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110327089 (Rdh5)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110327089 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 110327089
NCBI-ProteinID: XP_021061472
Ensembl: MGP_PahariEiJ_G0031123
Position
9
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDRQSLLASDAFIFITGCDSGFGRLLALQLDQKGFQVLAGCL
TPSGAEDLQQMASSRLHTTLLDITDPQNVQQVAKWVKTRVGETGLFGLVNNAGVAGIIGP
TPWLTQDDFQRVLSVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRIAANGGGYCVSKF
GLEAFSDSLRRDMAPFGVQVSIVEPGFFRTPVTNLESLESTLKACWARLPPATQAHYGEA
FLNTYLRVQRRIMNLICDPDLTKVTSCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAR
VVDAVLGWILPQPAQSVS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttctgggtgccttgctgtgggcagtgctgtggttgctcagagac
cggcagagcctgctggccagcgatgctttcatcttcatcactggctgtgactctggcttt
gggcgccttctggcactgcaacttgaccagaagggcttccaagtcctggccggctgcctg
accccctctggggcagaagacctgcagcagatggcctcctcccgcctccacacaacactg
ttggatatcactgatccccagaatgtccagcaagttgccaagtgggtgaagacacgtgtt
ggagaaactgggctttttggtctggtgaataatgctggcgtagctggtatcatcgggccc
acaccatggctaacacaggatgatttccagagagtgctgagtgtgaacactctggggccc
atcggggtcacccttgccctgctgcccctgctacagcaggccaggggtcgggtggtcaac
atcaccagtgtcttgggccgcatagcagccaatggtgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggacatggctccattcggagtacaagtc
tccattgtggagcctggcttctttcgaacccctgtgaccaacctggagagtctggagagc
accctgaaggcttgttgggcccggctacctccggctacacaggcccactatggggaagcc
ttcctcaatacttatcttcgagtgcagcgccgcatcatgaacctgatctgtgacccagac
ctaacgaaggtgaccagctgtctggagcacgccctgacggctcgccacccccgaacacgc
tacagcccaggctgggatgccaagctgctctggctgcccgcctcctaccttccagccagg
gtagtggacgctgtgctcggctggatccttccccagccggcccagtcagtctcctga

DBGET integrated database retrieval system