KEGG   Mus pahari (shrew mouse): 110327293Help
Entry
110327293         CDS       T05929                                 

Gene name
Hspa8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03040  Spliceosome
mpah04010  MAPK signaling pathway
mpah04141  Protein processing in endoplasmic reticulum
mpah04144  Endocytosis
mpah04213  Longevity regulating pathway - multiple species
mpah04612  Antigen processing and presentation
mpah04915  Estrogen signaling pathway
mpah05134  Legionellosis
mpah05145  Toxoplasmosis
mpah05162  Measles
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110327293 (Hspa8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110327293 (Hspa8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110327293 (Hspa8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110327293 (Hspa8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110327293 (Hspa8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110327293 (Hspa8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110327293 (Hspa8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110327293 (Hspa8)
  09172 Infectious disease: viral
   05162 Measles
    110327293 (Hspa8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110327293 (Hspa8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110327293 (Hspa8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mpah03041]
    110327293 (Hspa8)
   03009 Ribosome biogenesis [BR:mpah03009]
    110327293 (Hspa8)
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110327293 (Hspa8)
   04131 Membrane trafficking [BR:mpah04131]
    110327293 (Hspa8)
   03051 Proteasome [BR:mpah03051]
    110327293 (Hspa8)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110327293 (Hspa8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110327293 (Hspa8)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110327293 (Hspa8)
Spliceosome [BR:mpah03041]
 Complex B
  Other components
   Prp19 complex
    110327293 (Hspa8)
 Complex C
   Prp19-CDC5 complex
    110327293 (Hspa8)
Ribosome biogenesis [BR:mpah03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110327293 (Hspa8)
Chaperones and folding catalysts [BR:mpah03110]
 Heat shock proteins
  HSP70 / DNAK
   110327293 (Hspa8)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110327293 (Hspa8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110327293 (Hspa8)
Proteasome [BR:mpah03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110327293 (Hspa8)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110327293 (Hspa8)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110327293 (Hspa8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 110327293
NCBI-ProteinID: XP_021061798
Ensembl: MGP_PahariEiJ_G0014946
Position
10
AA seq 648 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLXXXXCHDIVLVGDSTRILKIQKLLQDFFNGKELN
SNEAVAYGVSVQAAISSGGKSENVQDLLLLDDLLLLDVTPLSLGIETAGGVMTVLIKRNT
TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTF
DIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSS
KNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIIXWLDKNQTAEKEEFEHQQKE
LEKVCNPIITKLYQSAGGMPGGMHGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatcttggcaccacctactcctgtgtgggtgtc
ttccagcatggaaaggtggaaattattgccaatgaccagggtaaccgcaccactccgagc
tacgttgctttcacggacacagagcgattaatcggggatgcggccaagaatcaggttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgatcggacgtaggtttgatgat
gctgttgttcagtctgatatgaagcactggcccttcatggtggtgaatgatgcnggcagg
cccaaggtccaagtggaatacaaaggggagacaaaaagtttctacccagaggaagtgtcc
tccatggttctgacaaagatgaaggaaattgcagaagcatacctcggaaagactgttacc
aatgccgtggtcacagtgccagcttacttcaatgactctcagcgacaggcaacaaaagat
gctggaactattgcaggcctcaatgtacttcgaatcatcaatgaaccaactgctgctgct
attgcttatggcttggataagaaggttggagctgaaaggaatgtgctgatttttgacttg
ggaggtggcacttttgatgtgtcaatcctcactattgaggatggaatttttgaagtcaaa
tcaacagctggagacacccacttgggtggagaagattttgacaaccgaatggtcaaccat
ttcattgctgagtttaagcgaaagcacaagaaggacatcagcgagaacaagagagctgtc
cgccgactccgcaccgcctgtgagagggccaagcgcaccctctcctccagcacccaggcc
agtattgagattgattctctctatgagggaattgacttctatacctccattacccgggct
cgatttgaggagttgaatgctgacctgttccgtggcacactggaccctgtagagaaggcc
cttcgagatgccaaactggnnnnnnnnnnntgtcatgatattgtcttggtgggtgattct
accagaattctcaagatccagaaacttctgcaagacttcttcaatggaaaagaactgaat
tctaatgaagctgttgcctatggtgtatctgtccaggcagccatttcatctggaggcaag
tctgagaatgttcaagatttgctgctcttggatgatttgctgctcttggatgtcactcct
ctttcccttggtattgaaactgctggtggagtcatgacggtcctcatcaagcgcaatacc
accatccccaccaagcagacacagactttcaccacctactctgataaccagccaggtgta
ctcattcaggtgtatgaaggtgaaagggccatgaccaaggacaacaacctgcttggaaag
tttgagctcacaggcatacctccagcaccccgtggggttcctcagattgaggttactttt
gacatcgatgccaatggcatcctcaatgtttctgctgtagataagagcacaggaaaggag
aacaagatcaccatcaccaatgacaagggccgcttaagtaaggaagatattgaacgcatg
gtccaagaagctgagaagtacaaggctgaggatgagaagcagagagataaggtttcctcc
aagaattccctggagtcctatgccttcaacatgaaagcaactgtggaagatgagaaactt
caaggcaagatcaacgatgaggacaaacagaagattcttgacaagtgcaatgagatcatc
anctggctggataagaaccagactgcagagaaggaagaatttgagcatcagcagaaagaa
ctggagaaagtctgcaaccctatcattaccaagctgtaccagagtgctggtggcatgcct
ggggggatgcatggtggcttccctggtggaggagctcccccatctggtggtgcttcttca
ggtcccaccattgaagaggtggattaa

DBGET integrated database retrieval system