KEGG   Mus pahari (shrew mouse): 110328476Help
Entry
110328476         CDS       T05929                                 

Gene name
Dock6
Definition
(RefSeq) dedicator of cytokinesis protein 6 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110328476 (Dock6)
Membrane trafficking [BR:mpah04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110328476 (Dock6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 110328476
NCBI-ProteinID: XP_021063534
Ensembl: MGP_PahariEiJ_G0014749
Position
10
AA seq 2113 aa AA seqDB search
MAASERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRSSSSLGVPLTEVIEPLDFEDVL
LSRPPEVEPGPLRDLIEFPADDLELLKQPRECRTTESGVPEDGKLDAQVRAAVEMYSEDW
VIVRRRYQHLSTAYSPITTETQRERQKGLTCQVFEQDTPGDERTGPEDADDPQHCSGSPE
DTPRSSGASGIFSLRNLTADSLLPTLLERAAPEDVDRRNEALRRQHRAPALLTLYPAPDE
DEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGTLALYDVREKKKISENFYFDL
NSDSVKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVVKLEKVLQQGDISECCEPYMV
MKEADTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSVGPQDRDSDSESE
RRPTWAERRRRGPQDRGYGGDDVCSFSSFRPATLTVTNFFKQEAERLSDEDLFKFLADMR
RPSSLLRRLRPVTAQLKIDISPAPENLHFCLSPELLHVKPYPDPRGRPTKEILEFPAREV
YAPHTCYRNLLFVYPHSLNFSSRQGSVRNLAVRIQYMAGEDQSQALPVIFGKSSCSEFTR
EAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLFFTFYHVSCQPRPGTALETPVGFTWIP
LLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAVSSVHPQ
DPHLDKFFTLVHVLEEGIFPFRLRETVLSEGTMEQELRASLAALRLASPEPLVAFSHLVL
DKLVRLVVRPPIICGQMVNLGRGAFEAMAHVASLVHRNLEAVQDSRGHCPLLASYVHYAF
RLPASDLSPPGEASPATVQAATLARGSGRPTSLYLARSKSISSSNPDLAVVPGSVDDEVS
RILASKGVDRSHSWVNSAYAPGGNKAVLRRVPPFCGADPRQAIDRNSSRASSYLEASSSA
LPAPQPRHTVQKLLHEELALQWVVSGSAVRELVLQHAWFFFQLMVKSMELHLLLGQRLDT
PRKLRFPGRFLDDIAALVASVGLEVITRVHKDMELAERLNASLAFFLSDLLSIADRGYIF
SLVRAHYKQVATRLQSAPNPAALLTLRMDFTRILCSHEHYVTLNLPCCPLSPPASPSPSV
SSTTSQSSTFSSQAPDPKVTSMFELSGSFRQQHFLSGLLLTELALALDPEAEGASLLHKK
AISAVHSLLCSHDVDSRYAEATVKAKVAELYLPLLSLARDTLPRLHGFAEGSGQRSRLAS
MLDSDTEGEGDIGGTINPSVAMAIAGGPLAPGSRTSISQGPSTAARSGCPLSAESSRTLL
VCVLWVLKNAEPALLQRWAAALALPQLGCLLDLLYLCLAAFEYKGKKAFERINSLTFKKS
LDMRARLEEAILGTIGARQEMVRRSRERSPFGNQENVRWRKSVTHWRQTSDRVDKTKDEM
EHEALVDGNLATEASLVVLDMLEIIVQTVMLSEARESILSAVLKVVLYSLGSTQSALFLQ
HGLATQRALVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRTHASASLYLLMRQNFE
IGHNFARVKMLVTMSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDVGLRDSTFAEQVQDL
MFNLHMILTDTVKMKEHQEDPEMLMDLMYRIARGYQGSPDLRLTWLQNMAGKHAELGNHA
EAAQCMVHAAALVAEYLALLEDSRHLPVGCVSFQNVSSNVLEESAISDDILSPDEEGFCS
GKNFTELGLVGLLEQAAAYFTMGGLYEAVNEVYKNLIPILEAHRDYKKLAAVHGKLQEAF
TKIMHQSSGWERVFGTYFRVGFYGTRFGDLDEQEFVYKEPSITKLAEISHRLEEFYTERF
GDDVVEIIKDSNPVDKSKLDPQKAYIQITYVEPHFDTYELKDRVTYFDRNYGLRAFLFCT
PFTPDGRAHGELAEQHKRKTLLSTEHAFPYIKTRIRVCHREETVLTPVEVAIEDMQKKTR
ELAFATEQDPPDSKMLQMVLQGSVGPTVNQGPLEVAQVFLSEVPEDPKLFRHHNKLRLCF
KDFCKKCEDALRKNKALIGPDQKEYHRELERHYSRLREALQPLLTQRLPQLLAPSSTSLR
NSMNRSSFRKADL
NT seq 6342 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcggagcgccgcgccttcgctcacaagatcaacaggactgtggctgctgag
gtccggaagcaggtgtcccgggagcgcagtggctcaccccactccagccgtcgctccagt
agttccctgggggtccctctgacggaggtcatcgaacccctggactttgaggacgtgctt
ctgagccggccacctgaagtcgagcccggtcccctcagggacttgatagagtttccagca
gatgacttagaactactgaagcagccccgagaatgccggaccacagagtctggggtgccg
gaggatggaaagttggatgcccaggtgagggctgcggtggagatgtactcagaggactgg
gtcattgtacgcagaaggtaccagcacctgagtacagcatacagccccatcactacagag
acacagcgagagcggcagaaaggcctcacctgccaggtcttcgagcaggacacccctggg
gatgagaggacgggtcctgaggatgcggatgacccccaacactgttcaggctccccagag
gacacccctcgaagcagtggcgcctcaggcatcttcagcctgaggaacctgactgcggac
tctctgctgcccacgctgctggagcgggcggcccctgaggatgtggaccggcgcaatgaa
gccctcaggcggcagcaccgggcccccgccctgctcaccttgtacccagcacctgatgag
gatgaagctgtagaacgctgcagccgccccgagccacctcgagagcactttggacagagg
atactggtgaagtgtctgtcactcaagtttgagattgaaattgaacccatctttggcacc
ttggccctgtatgatgtgcgggagaagaagaagatttcagaaaacttctactttgaccta
aactcggactccgtcaaggggctgctccgggcccatggcacccacccagccatctccacc
ttggcacgctctgccatcttctccgtgacctacccatctcctgacatcttcctggttgtc
aagctggaaaaggtgctgcagcagggggacatcagtgagtgctgcgaaccctacatggtg
atgaaggaggcggacacagcgaagaacaaagagaagctggagaagctgcgcttggccgct
gagcagttctgcaccaggctgggccgctaccgcatgcccttcgcctggacggctgtgcac
ctggccaacatcgtgagcagcgtggggccccaggaccgggattccgactccgagagcgaa
cgcagacccacctgggccgaacgccgccgtcgggggccccaggatcgaggctatggtggg
gatgatgtctgcagcttctctagcttccgcccggccacgttaactgtcaccaactttttt
aaacaggaggcagaacggctcagtgatgaagaccttttcaagtttctggcggacatgcgg
cgaccatcctccctgctgaggcgattgcgacctgtgactgctcagctcaagattgacatc
tcccctgcccccgagaacctgcacttctgcctgtcccctgagttacttcatgtcaagccc
taccctgaccccaggggacggcccaccaaggagatcctggagttccctgcccgtgaggtc
tacgccccccatacctgttacaggaacctgctctttgtatacccacacagcctcaatttc
agcagtcgccagggctctgtgcgcaacctggccgtgcggatccagtacatggcaggcgaa
gaccagagtcaggccttgccggtcatctttgggaaatctagctgcagcgaattcacccga
gaggccttcacaccagtggtctatcataacaagtctcctgaattctacgaggaattcaag
ctacgacttcctgcctgcgtgactgagaaccatcacctcttttttaccttctaccatgtc
agctgccagccccggccaggaacagccctggaaacgcctgtgggcttcacttggatccct
ctgttacaacatggccgtctgaggactggtcccttctgcctgcccgtgtctgtggaccag
cctccacccagctactcagtcctgaccccggatgtagcactgcctggcatgcgctgggtg
gatggccacaagggcgtgttcagcgtggagctcaccgctgtgtcgtctgtgcacccccag
gacccccacttggataagttcttcactctggtacatgttctagaggaaggaatctttcca
ttccggctcagggagacagtgctgagcgaaggcactatggagcaggagttacgagccagc
ctggcagccctgcgccttgccagcccagagccccttgtggccttttcccacctcgtgcta
gacaagcttgtccgcttggttgtgcggccacccatcatttgtggccagatggtgaacctg
ggtcgaggggcctttgaagctatggctcatgtagccagccttgtgcaccggaacctggag
gccgtccaagattcccgtggccactgcccactgctggcctcctatgtccactacgccttt
cgcctccctgccagtgacctcagcccgccaggcgaagcctctccagcaactgtgcaggct
gccacactggcccgcggctccggtcgccccaccagcctgtacctggcacggtctaagagc
atcagcagcagcaaccctgacctggccgtggtccctggctctgtggacgatgaggtgtcc
cgcatcctagccagcaagggtgtcgatcgctcacactcctgggtgaattctgcttatgct
ccaggcggcaacaaggctgtgctgcggcgggtgcccccattctgtggggcggaccccaga
caggccatcgaccgcaactctagccgggcctcctcttacctcgaggcctcctcctcggcc
ctgccagcccctcagccgagacacactgtgcagaagctgctgcacgaggagctggctctg
cagtgggtggtgagcggcagtgcagtgcgcgagctggtcctgcagcatgcctggttcttt
ttccaactcatggtaaaaagcatggagctccacctgctcctgggccagcgactggacact
ccccgaaagctgcgcttccctgggcgcttcctggacgacatcgccgccctggtggcttct
gtgggcctggaagtcatcacccgagtccataaggacatggagctagccgaacgcctcaac
gctagcctggccttcttcctcagtgacctcctgtccatagcggaccgaggctacatattc
agcctggtacgcgctcactacaagcaggtggccactcggctccagtctgcccccaaccca
gctgcactgctcacactacgaatggacttcacccgcatcctgtgtagccacgagcactac
gtgacccttaacctcccttgttgccccctgtcgcccccagcatccccgtccccctcggtg
tcctccactacctcccagagctccaccttctccagtcaggcccctgacccgaaggtgacc
agcatgttcgagctgagtgggtccttcaggcagcagcacttcctgtctggactcctgctg
acagagctggccctggcactggatccagaagctgagggggcatcccttttgcacaagaag
gccattagtgcggtgcacagcctgctgtgcagccacgatgttgactcccgctacgcagaa
gctaccgtgaaggccaaggtggccgagttgtacctgcccctcctctcccttgcaagggac
acactgccacggctgcatggctttgccgagggctcggggcagcggtcaagactggcttcc
atgctggactcagacacagaaggtgaaggggatatcggaggcaccatcaacccatctgtg
gccatggccattgctgggggtcccctggctcctggctctcgtaccagcatttcccaggga
ccttcaacagcagctcgctcaggctgtcccctctctgctgaatccagccggaccttgctg
gtgtgtgtgctgtgggtcttgaagaatgcagagccggcgctcctgcagcgctgggctgcc
gccctggccctgccccagctggggtgcctcctcgacctactctacctctgtctggctgcc
ttcgagtacaaggggaagaaagcctttgagcggatcaacagcctcacgttcaagaagtct
ctggacatgagagcgcggctggaggaggccatcctgggcaccataggggcacggcaggag
atggtgcggcggagtcgggagagaagtccatttggaaaccaagagaatgttcgctggcgt
aagagtgtcacacactggagacagacctcagaccgtgtggacaagaccaaggatgaaatg
gaacacgaagctctggtggacggaaacctggcgacagaggccagcctggtggtcctggac
atgctggagatcatcgtgcagacagtgatgctgtccgaggcccgggagagcatcctgagt
gctgtgctgaaagtcgtcctctacagtctggggagcacccagagcgcgctgttcctgcag
catggcctggccacccagcgggccctggtctccaagtttccggagctgcttttcgaggaa
gacacggagctttgtgctgacctctgcttgaggctcctgcgacattgtggcagccgcatc
agcaccatccgaacgcacgccagcgcctcactctacctgctcatgcgccagaacttcgag
attggccataactttgcccgtgtgaagatgctggtgaccatgtctctgtcgtcccttgtg
gggacaactcagaactttagtgaagagcatttgagaaggtccctcaagactatccttacc
tatgcagaggaggacgtggggctgagggacagcaccttcgctgagcaggtccaggacctc
atgttcaacctgcacatgatcctgacagacacagtgaagatgaaggagcaccaggaggac
cctgagatgctcatggacctcatgtacagaattgcccggggataccaaggctctccagac
ctgcggctgacatggctgcagaacatggctggcaaacatgcagagctgggcaatcatgca
gaggctgcccagtgcatggtccacgccgctgccctggtggccgaataccttgccctcctt
gaggacagtcgccacctgcccgtgggctgtgtgtccttccagaatgtctcatccaatgtg
ctggaggagtctgccatctctgatgacatcctgtcaccagatgaggagggcttctgctct
gggaagaacttcacagaactgggtctggtggggctgctggagcaggcggccgcctacttc
accatgggtggtctgtatgaagcagtgaacgaagtctacaaaaaccttatccccatcctc
gaagcccacagagactacaagaagctggccgcagtgcacgggaaactgcaggaggccttc
accaagattatgcaccagagctctggctgggagcgtgtatttgggacgtatttccgagtg
ggcttctatggcacacgatttggtgacctggatgaacaagagtttgtgtacaaggaaccg
tcaatcacgaagctcgcagagatctcacaccggctggaggagttctatacggaaaggttc
ggggatgatgtggtagagatcatcaaagattctaacccggtggacaagtccaagctggat
ccacagaaggcttacatccagataacctatgtggagccgcatttcgacacttatgagctc
aaggatcgggtgacctactttgaccggaactatgggctgcgggccttcctcttctgcaca
cccttcacgccggatggacgtgcgcacggagagttggccgaacagcacaagcggaagacg
ctgctgagcacagagcacgcctttccctatatcaagacacgcatccgagtgtgccaccgt
gaggagacagtgctgacaccagtggaggtagccattgaggacatgcagaagaagacacgg
gagctggcctttgccaccgagcaggaccctccagattccaagatgctgcagatggttctc
cagggctctgtgggacccactgtgaaccagggtcccttggaagtggcccaggtgtttttg
tcagaggtcccagaagatcccaagctcttccgacatcacaacaaactacggctctgcttc
aaggatttctgtaaaaagtgtgaggatgcactgagaaagaacaaggcccttattggtcca
gaccagaaagagtaccaccgggagctggagcgccactacagccgcctgcgggaggctctc
cagcctctgctcacccagcgtctgccccagcttctggcaccaagttccaccagcctcagg
aactccatgaacagatcgagtttcaggaaggctgacctctga

DBGET integrated database retrieval system