KEGG   Mus pahari (shrew mouse): 110328996
Entry
110328996         CDS       T05929                                 

Gene name
Anpep
Definition
(RefSeq) aminopeptidase N
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00480  Glutathione metabolism
mpah01100  Metabolic pathways
mpah04614  Renin-angiotensin system
mpah04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110328996 (Anpep)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110328996 (Anpep)
  09152 Endocrine system
   04614 Renin-angiotensin system
    110328996 (Anpep)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110328996 (Anpep)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110328996 (Anpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110328996 (Anpep)
   04090 CD molecules [BR:mpah04090]
    110328996 (Anpep)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     110328996 (Anpep)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110328996 (Anpep)
Membrane trafficking [BR:mpah04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    110328996 (Anpep)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   110328996 (Anpep)
CD molecules [BR:mpah04090]
 Proteins
  110328996 (Anpep)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF5700
Other DBs
NCBI-GeneID: 110328996
NCBI-ProteinID: XP_021064186
Ensembl: MGP_PahariEiJ_G0013111
Position
1
AA seq 966 aa
MAKGFYISKTLGILGILLGVAAVCTIVALSVVYAQEKNRNAENSVTAPTLPANTSVTTSA
TTPAVDESKPWNQYRLPKTLIPDSYRVILRPYLTPNNQGLYIFQGNSTVRFTCNESTNVI
IIHSKKLNYTLKGNHMVALRALGGTQAPNINKTELVERTEYLVVHLQGFLVKDQQYEMDS
EFQGELADDLAGFYRSEYMEGGVKKVVATTQMQAADARKSFPCFDEPAMKATFNITLIYP
NNLIALSNMFPKESKPYPEDPSCIMTEFHSTPKMSTYLLAYIVSEFKNISSVSANGVQIG
IWARPSAIDQGHGDYALKVTGPILNFFAQHYNTAYPLPKSDQIALPDFNAGAMENWGLVT
YRESSLVFDPQSSSISNKERVVTVIAHELAHQWFGNLVTVAWWNDLWLNEGFASYVEYLG
ADYAEPTWDLKDLMVLNDVYRVMAVDALASSHPLSSPANEIETPAQIMELFDSITYSKGA
SVLRMLSSFLTEDLFKKGLASYLNAYQYSNTVYLDLWEHLQKAVNQQTAVQLPAPVSTIM
DRWILQMGFPVITVNTNTGEISQEHFLLDPKSNVTRPSQFGYLWIAPIPFLKNGREDHYW
LEVQKNQSEKFRTSSNEWILLNINVTGYYQVNYDENNWRKLQNQLQTDLSVIPVINRAQI
IHDSFDLASAQKILITLALNNTLFLVKEIEYMPWQAALSSLNYLTLMFDRSEVYGPMKRY
LKKQVTPLFFYFQNRTNNWTTRPLTLMEQYNEINAISTACSSGLKECKDLVVGLYSQWMS
NPNNNPIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRNATLVNEADKLRSALACSKDVWIL
NRYLSYTLNPDYIRKQDATSTIISIASNVAGQSLVWDFVRSNWKKLFEDYGGGSFSFANL
IQGVTRRFSSEFELQQLEQFKAENSATGFGTGTRALEQALEKTKANINWVKENKDVVFKW
FTENSS
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggccaaggggttctacatttccaagaccctgggcatcttgggcatcctgttgggtgtg
gcagcggtgtgtaccatcgtagctctgtcggtggtctatgctcaggagaagaataggaat
gcagagaactctgtcacagcccccacgctcccggccaacacctcagtcaccacctcagcc
accacccctgctgtagatgaaagcaagccttggaaccagtatcgcttgcctaagactctt
atacctgactcctaccgggtgatcctgagaccctacctcacccccaacaaccagggcctg
tacatcttccaaggcaacagcaccgttcgctttacctgcaacgagtccacgaatgtcatc
atcatccacagcaaaaagctcaactacaccctcaaaggaaaccacatggtggcgttacga
gccctgggtggcacccaggcacctaacattaacaaaacggaactggtagagcgtactgaa
tacctggtggtgcacctgcaggggttcctggtaaaggaccaacagtacgagatggacagt
gagttccagggggaactggctgatgacctggctggcttctaccgcagcgagtacatggaa
ggaggcgtcaagaaggtggtggctacaacgcagatgcaggccgctgatgcccggaaatcc
ttcccgtgctttgatgagccagccatgaaggccacgttcaacatcacgctcatctacccc
aacaacctcatagctctgtctaatatgtttcccaaagagtccaagccctatccggaagac
ccttcttgcatcatgactgagttccactccacccccaagatgtccacgtacctgctggcc
tacatcgtgagcgagttcaaaaatataagctccgtctcagccaatggtgtccagattgga
atctgggctcggcccagtgccattgatcagggccacggtgattatgcactgaaagttaca
ggccccatcctaaatttctttgcccaacattataatacagcctaccctctaccaaagtct
gaccagatcgccctgcccgacttcaacgctggagccatggagaattgggggctggtgacc
taccgtgagagctccctggtcttcgaccctcagtcctcctccattagcaacaaggagcgg
gtggtcactgtgattgctcacgagctggcccatcagtggttcggcaacctggtgactgtg
gcttggtggaatgatctgtggctgaatgagggctttgcctcctacgtggaatatctgggt
gctgactatgcagagcccacctgggatctgaaagacctcatggtactgaatgacgtgtac
cgtgtgatggcagtggatgctctcgcctcctcccacccactgtccagtcctgccaacgag
atcgaaacaccagcccagatcatggagctgtttgacagcatcacctacagcaagggagcc
tccgtcctcaggatgctgtccagtttcctgacagaggacctgtttaagaagggccttgca
tcttatctcaatgcctaccagtactcgaacaccgtttatctggacctgtgggaacacctg
caaaaggccgtgaaccaacagacagctgtccaactcccggccccagtgagcactatcatg
gaccgctggattctacagatgggctttcccgttatcactgtgaacaccaatacaggagaa
atctcccaggaacacttcctcctggaccccaagtccaacgttacccgcccctcccagttt
ggttacctctggatcgcgcccattccgtttctcaaaaatggacgggaggatcactactgg
ctggaggtccagaaaaaccagagtgaaaagttccggacatcctccaatgaatggatctta
ctgaacattaatgtaaccggctactaccaggttaactatgacgaaaacaactggaggaag
cttcaaaatcagttgcaaacagacctttctgttatccctgtcatcaaccgagcacagatt
attcacgactccttcgacctggccagtgctcaaaagatactcatcaccctggcgctgaac
aacactctcttcctggtcaaagaaatagagtacatgccctggcaggctgccctgagcagc
ctcaactacttgacgctcatgttcgaccgttcggaggtctatggccccatgaagaggtat
ctgaagaagcaagtcacgcccctcttcttctacttccaaaatagaaccaacaactggacc
actcgtcccttgacgctgatggagcagtacaatgaaattaacgccatcagcactgcctgt
tccagtggtctcaaagagtgtaaggacctggtcgttgggctttatagtcagtggatgagc
aaccctaataataacccgatccaccccaaccttcggtctactgtctactgcaatgccatt
gctttcggtggcgaggaagagtggaactttgcttgggaacagttccggaacgcaactctg
gtgaacgaggcagacaaactccgatcagccttggcctgtagcaaagatgtgtggattttg
aacaggtacctaagttacactctgaacccggactacatccggaagcaggacgccacctcc
accatcatcagcatcgccagcaatgtggctgggcagtctctggtttgggactttgtccga
agcaactggaagaaactgtttgaggattacggcggaggatctttctcctttgccaatctc
atccagggagtgacccggcgcttctcctctgagtttgagctgcagcagctggagcagttt
aaggcagaaaactcggccacaggcttcggcaccggcactcgggctctggagcaagccctg
gagaagacgaaggccaacatcaactgggtgaaggagaacaaagatgtggtattcaagtgg
ttcacagagaacagcagttag

DBGET integrated database retrieval system