KEGG   Mus pahari (shrew mouse): 110329158
Entry
110329158         CDS       T05929                                 

Gene name
Ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110329158 (Ahrr)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110329158 (Ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 110329158
NCBI-ProteinID: XP_021064405
Ensembl: MGP_PahariEiJ_G0015798
Position
11
AA seq 698 aa
MMIPSGECTYAGRKRRKPIQKRKLTLGAEKSNPSKRHRDRLNTELDHLASLLPFSPDIIS
KLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEEHPYRGFPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVF
GQSPHADTDSTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKTPSGTVLPPRLSLFCIVAPVLPSVTEMKMKSTFLKAKHRADIVVTMDSRA
KAVTSLCESELRPKLNYLAGRSNGENGISLFRGQTDRSHWARALARSSCLCLRGGPDLLD
PKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPVHLRHLNWSTQQPSQEGTTKL
TRQPSKNEPSTCLVPHVPYPGSQGMLSASNMASFRDSLDHPTGAYCSQMNRPLPDIHQGQ
VDPSTCHISQGSLGSRIPLPGMQRFTARGFSTEDAKLPSLPVTIGTPCNPVLSLDVPIKM
ENESGSQDIVEASTTSCVWLGTSDMARRHLVGFPARMHLKTEPDYRQQACTPHLGHGMLG
TNPYSRDTVGSCREHAPLYSAHCTCLDPELPHHLFMCSHSESQHPSLDQDCRAPIVKREP
LDSPSWAAPGQVTVPRMFPKSASITVIPSKGSDGIFLP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgatgattccatcaggagagtgtacatatgccggtaggaagagaaggaaacccattcag
aagcggaagcttaccttgggagctgagaaatcaaatccttctaaacggcaccgggaccgc
ctcaatacagagctggaccacctggccagcctgctgccattttcacctgatatcatctcc
aagctggacaagctttctgtcctgcgcctcagcgttagctacctcagggtgaagagcttc
ttccaagccttgcaagagacatgtgtatggtcagctccagccctgtcacctgaagaacac
ccatacagagggttccctgttcaggaaggacggctgctgctggagtctctcaatggcttt
gctctggtggtgagtgccgaagggatgatcttttatgcatcggcaacgattgtggactat
ctgggcttccatcagacagatgtaatgcatcaaaacatttatgactacatccatgtggat
gaccggcaggacttctgcagacaactacactgggccatggaccctcctcaggtggtgttt
gggcagtccccacatgctgacacagacagtactgtcctggggaagctgctcagggcccaa
gaagggggcaagggcttgccctcagagtactcggccttcttgacacgctgcttcatttgc
cgtgttcgctgcctgctggacagcacctctggctttctgactatgcagttccaaggaaaa
ctaaaattcctatttggacagaagaagaagacaccatcaggaacagttctgcctcctcgg
ctctcactgttctgcattgtggctccagtcttgccttctgtgactgagatgaaaatgaaa
agcacattcttgaaggcgaagcacagggcagacattgtggttacgatggactcaagggca
aaagctgttacaagtctatgtgaatcagaattgcgtcccaaactcaattacttagcagga
aggagcaatggagaaaatggcatttcactgttcaggggacaaacagataggagccactgg
gcccgggctctagccaggtcttcatgtctgtgcctcaggggtggtcctgacctgctggac
cccaaggggacttcaggggacagagaagaggaggaccagaagcacatactaaggagatcc
cctggtgcctggggacagagggagatgcacaagtacagttatggcttggagacaccagta
cacttgaggcacctgaactggagcacacaacagccaagtcaggagggcactaccaagctg
actcggcagcccagtaagaatgagccatccacatgtctggtgccccatgtgccctaccct
ggaagccagggtatgctcagtgccagcaacatggcttcttttagagattcactagatcat
cccactggtgcctactgcagtcagatgaacagacccttgccggatatccaccagggccag
gtggatccttccacctgccatatctcccagggcagtctgggatctaggatccctcttcct
ggaatgcagcgcttcacagctaggggattttctacagaggatgcaaaattgcccagcctg
ccagtgaccataggcaccccatgcaacccagtattgtcactggatgtgccaatcaagatg
gagaatgaatctgggtcccaggatatagttgaagctagcacaactagctgtgtgtggctg
ggaaccagcgacatggccagaagacatctggttggtttccctgccaggatgcacctgaaa
acagagcccgactataggcagcaggcctgtaccccacaccttggtcatggtatgctggga
actaatccctacagcagagatactgttggatcctgtagggagcatgctcctctttactct
gcacattgcacctgcctggatccagagcttcctcatcacctcttcatgtgtagccacagt
gagagccagcacccttcattggaccaagactgcagagctcctattgttaagcgtgagcct
ctggactcaccatcatgggctgctcctggtcaggtgactgtgcccaggatgttccctaag
agtgcctctataactgtgatcccatccaaaggctctgatggaattttcctaccctag

DBGET integrated database retrieval system