KEGG   Mus pahari (shrew mouse): 110331258Help
Entry
110331258         CDS       T05929                                 

Gene name
Mrpl22
Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    110331258 (Mrpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mpah03011]
    110331258 (Mrpl22)
Ribosome [BR:mpah03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    110331258 (Mrpl22)
  Bacteria
    110331258 (Mrpl22)
  Archaea
    110331258 (Mrpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 Ribosomal_S6e
Motif
Other DBs
NCBI-GeneID: 110331258
NCBI-ProteinID: XP_021067385
Ensembl: MGP_PahariEiJ_G0017521
Position
14
AA seq 184 aa AA seqDB search
MAAALLRELGALRVPNLGIWATQTLRVLPPSCIHTSASLDISRKWEKKNKIVYPPQLPGE
PRRPAIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAASTSG
RGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEAPKTAVDHAKDYIQQLRSRTI
VHTL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcactactgcgagagttgggtgcactgcgggtacctaacctggggatctgg
gcaacgcagacgctgcgggttttacccccgtcgtgcatccacacgagtgcttctcttgac
atttctcgaaaatgggagaagaagaataagattgtttacccacctcagctgcctggtgaa
cctcggagaccagcaatacgaggcatgtccattgatcaggctttggcgcagctggagttc
aatgataaaaagggggctcagatcattaaagaggttctcttagaagcacaagacatggca
gtgagagaccataatgtggaattcagatccaacttacacatagctgcgtctacctcaggc
cgaggccagtgcctgaagcgcatccgttaccatggccgaggccgctttggcatcatggag
aaggtctattgccactattttgtgaagctggtggaaggacccccacccccacccgaagca
cccaagacagcagttgaccacgccaaggactatattcagcagcttcgcagccggaccatt
gtccatactctatga

DBGET integrated database retrieval system