KEGG   Mus pahari (shrew mouse): 110331520
Entry
110331520         CDS       T05929                                 

Gene name
Npepps
Definition
(RefSeq) puromycin-sensitive aminopeptidase isoform X1
  KO
K08776  puromycin-sensitive aminopeptidase [EC:3.4.11.-]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110331520 (Npepps)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110331520 (Npepps)
Peptidases and inhibitors [BR:mpah01002]
 Metallo peptidases
  Family M1
   110331520 (Npepps)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 110331520
NCBI-ProteinID: XP_021067859
Ensembl: MGP_PahariEiJ_G0018180
Position
14
AA seq 921 aa
MWLAAAVPSLARRLLLLGPPPPPLLLLLSRSSRRRRRRLHSLGLAAMPEKRPFERLPAEV
SPINYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYVPEGDEEIHAT
GFNYQNEDEKVTLSFPRTLQTGTGTLKIDFVGELNDKMKGFYRSRYTTPAGEVRYAAVTQ
FEATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFART
PVMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNV
PYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQW
FGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHP
IEVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDL
WESLESASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRVLKLSQKKFCASGPYGGEDCP
QWMVPVTISTSEDPSQAKLKILMDKPEMSVVLKNVKPDQWVKLNLGTVGFYRTQYSSAML
ESLLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSGN
LGILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGH
KATLEEARRRFKEHVEGKQVLSADLRSPVYLTVLKHGDGATLDIMLKLHKQADMQEEKNR
IERVLGATLSPELIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEEL
HNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWL
KRDAESIHQYLLQRKTSPPSV
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgtggctggcagccgccgtcccctccctcgctcgccgcctgctcctcctcggccctccg
cctcctcccctccttctccttctcagtcgctcctctcgccgccgccgccgccgcctccac
agcctgggcctcgccgcgatgccggagaagcggcccttcgagcggctgcccgccgaggtg
tcgcccatcaactacagcctctgcctcaagcccgatttgctggacttcaccttcgagggc
aagctggaggccgccgcccaggtaaggcaggcaaccaatcaaattgtgatgaattgtgct
gatattgacattattacagcttcatatgtgccagaaggagatgaagaaatccatgcaaca
ggatttaactatcagaatgaagatgagaaagtcaccttgtcttttcctcgcactctccaa
acaggtacaggaaccttaaagatagattttgttggagagctgaatgacaaaatgaaaggt
ttctacagaagtagatacaccactcctgccggcgaggtgcgctacgctgctgtcacacag
tttgaggctactgatgcccgaagggcttttccttgctgggatgagcctgctatcaaagca
acttttgatatctcgctggttgtgcctaaagacagagtggctttatcaaatatgaatgta
attgacaggaaaccatatcctgatgatgaaaatttagtggaagtgaagtttgctcgcaca
cctgttatgtctacgtatctggtggcatttgttgtgggtgaatatgactttgtagaaaca
aggtcaaaagatggtgtgtgtgtccgtgtttacacccctgttggcaaagcagagcaagga
aagtttgcgctcgaggttgctgctaaaactttgcctttttataaagactacttcaatgtt
ccttatcctctacctaaaattgatctcattgctattgctgactttgcagctggtgccatg
gagaactggggccttgttacttatagggaaacggcattgcttattgatccaaaaaactcg
tgttcttcatcacgccagtgggttgctctggttgtgggacatgaactcgcccatcaatgg
tttggaaatcttgttactatggaatggtggactcacctctggttgaacgaaggctttgca
tcctggattgagtatctttgtgtagaccactgctttccagagtatgatatctggactcag
tttgtttctgccgattatacccgtgcccaggaacttgatgccttagataacagccatccg
attgaagtcagtgtgggccatccatctgaggttgatgaaatatttgatgctatatcatat
agcaaaggtgcatctgtaatccgaatgctacatgactacattggcgataaggactttaag
aaaggaatgaatatgtatttaaccaagttccaacaaaagaatgctgccacagaggatctc
tgggaaagtttggaaagtgccagtggcaaacccatagcagctgtgatgaatacctggacc
aaacaaatgggattccctctcatttatgtggaagctgaacaggtagaagatgacagagtg
ctgaagctgtctcaaaagaagttctgtgccagtggaccatatggcggtgaagactgtcct
cagtggatggttcctgtcacaatttcaactagtgaggatcccagccaggctaaactgaaa
atactaatggataagccagagatgagtgtggttttgaaaaatgtcaaaccagaccaatgg
gtaaagctaaatctgggaacagttgggttttatcgaacccagtacagctctgccatgctc
gaaagtttattaccaggcatccgtgacctttctctgcccccagtggaccgacttggatta
cagaatgacctcttttctctggctcgagctggcatcattagcactgtagaggttctaaaa
gtcatggaggcttttgtgaatgagcccaattatactgtatggagcgacctgagcggtaac
ctggggattctttcaactctcttgtcccacacagacttctatgaggagatccaggagttt
gtcaaagatgtcttttcacctataggagagagattgggctgggaccccaaacctggagaa
ggtcatctagacgcactcctgaggggcttggtgctgggcaaactgggaaaagcagggcat
aaggcaactttggaagaagcccgtcgtcggtttaaggagcacgtggaagggaagcaggtt
ctttctgctgacctaaggagtcctgtctatctcactgttttaaagcatggggatggcgct
accttagatatcatgctgaagcttcacaaacaagctgatatgcaagaagagaaaaacaga
attgaaagagttcttggggctactctttcacctgaactgattcaaaaagtcctcactttt
gcactttcagaagaggtccgtccgcaggacactgtgtcggtgattggcggagtggctgga
ggcagcaagcatgggaggaaagctgcttggaaattcatcaaggacaactgggaggagctt
cacaaccggtaccagggagggttcttaatatccagactaataaagctgtcagtggagggg
tttgcagttgataaaatggctggagaagttaaggctttcttcgagagtcacccagctcct
tcagctgagcgtaccatccagcagtgttgtgaaaatatcctgctgaatgctgcttggctc
aagcgagatgctgagagtattcaccagtacctccttcagcggaaaacctccccaccctca
gtgtga

DBGET integrated database retrieval system